1. Python / Говнокод #28735

    0

    1. 01
    2. 02
    3. 03
    4. 04
    5. 05
    6. 06
    7. 07
    8. 08
    9. 09
    10. 10
    11. 11
    12. 12
    13. 13
    14. 14
    15. 15
    16. 16
    17. 17
    18. 18
    19. 19
    20. 20
    21. 21
    22. 22
    23. 23
    24. 24
    25. 25
    26. 26
    27. 27
    28. 28
    from miditk.smf    import MidiSequence
    from miditk.common import constants
    from sys           import argv
    import datetime
    
    sequence = MidiSequence.fromfile(argv[1])
    dt0      = datetime.datetime(1,1,1)
    tail     = ''
    
    for time, group in sequence.events_by_time():
         ms          = datetime.timedelta(milliseconds=time)
         pretty_time = (dt0+ms).strftime('%M:%S.%f')[:-4]
         
         for ev in group:
             if ev.meta_type == constants.TEXT:
                 text = ev.data.decode('windows-1251')
                 if text and (text[0] == '@' or text[0] == '/' or text[0] == '\\'):
                     if tail: # выводим отложенный текст
                         if tail[0] == '\\': # отбиваем абзац
                             print(f'[{pt}]') 
                         if tail[0] == '@':  # шапка, убираем префиксы типа @T, @L
                             print(f'[{pt}]{tail[2:]}')
                         else:
                             print(f'[{pt}]{tail[1:]}')
                     pt = pretty_time
                     tail = text
                 else:        # откладываем текст на потом
                   tail = tail + text

    Наговнякал на коленках конь-вертер текстов песен из .KAR (.midi со словами в событиях типа 1 = TEXT) в .LRC, чтобы готовые тексты можно было использовать с проигрывателями mp3- или flac-файлов.

    Зависит от https://pypi.org/project/miditk-smf/

    Запостил: ropuJIJIa, 12 Апреля 2023

    Комментарии (1323) RSS

    • показать все, что скрытоSEO-псто.

      В принципе, можно переделать под .SRT.

      #KAR2LRC #MID2LRC
      Ответить
    • показать все, что скрытоКстати, событие типа 5 = LYRIC хоть каким-нибудь ПО используется?
      Ответить
    • ты скрипт-кидди, да?
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      CBZYORYFEVFFFYBKPAKLKILLFZCEDXFSDKMBHQPA FGPKVTVCDWXFFAJRYVFCYPPATULUNWAENKOAGVAN ERRORDNAPISZNWSKCWBUUJFNTXFSYKAUSYQTMKNS FYLYGWKCNMHMYAJWTHNIXSZOMTVWGOZGGOMSMBCT LUSEDCPCFXOREPRARLEQDPYVNUVNMSUIOXVKHYLL EAXLWZCNCQHFMLDOAVMPLDYPUVDQXTAOIJKRZDEG XOQHFTKHSVHXJBTHJICGAOKYQELXYELESNHTSWUC DNDTOAEBYDMRTWJGLZVJDYWBZINXCMBJQJXIAOJT KNKHBXSWXIROYYFZCRATHAINGAHRNQKSICKLMPDS YMJOUQCQZMFVUWGQGWAUAROTMMNKJZCEXZACDNQF KFSCUMNXRIQZYQUBNFXLDQKIANQHIOHGLRXTJDRM CBSVKYWAIVBRSIDNLETJZAWQZXEBYVYQQFURHPVN SFBMWYNTRHDIQPZEFWABALNURTYXFIQZJNQQNAQO LRFUYLWVOVAGWGTWEIQINAJMEQPAGKTAADWZZINN VNGNOTJCGZBJMSPFZJNEPTWORIUDBGFGGADEMRMD LZWPTSWAXMRYANMBJLUMVBWHZYOTQCSOTJGQYFPO WLFRUSGCGRYSSAVVLGWJPJQHODYWSMKJHHKCAXFT BZITSMFVKZHFEKGWZYZGIMOSJAZRORYBSXKRIGWQ MUIPHYOWGZRHTETGRAOGUFHVLENJGOMIBQDKOFUG XBFCQZYUMCBCBXOFZLGHBWVBCBOPOHZMNCEZHXXY JGMGIAQQRYLPEIOBERJEAJDPQNDEEQYOGQSVCDPZ EIYAAQKTMJKVXDFBCEFACJIKVWJFZJBYZTZFCVTM QSOYGOTAEWORTXFIRIJSDRWOKCQVMEXLNHPEPWHP VZUYLJEDJCNAFLDUWHHTEWDQCHSRHULILGXNXEUS HAXMTHGEWFLEXLEEIBHNDYDBXKNJXTKNMROFCSYU LHJUNKFDAURWBIVRRZVLALTFRXFMDFFVCECBXTWN EJJRSGOIKTNQDDBMHWOKNXAPAWQMCQKVOIRHJEVT GQCQQUVHTPBWGWPXVGGDQUELRDRKTDUTTQRFLANV LRMXJDGQBLTAENSXDRPNNWFJKIERVLCZBUXCLSXR IVMQCWXUQBQVDTBSJTKZDAJTKDKLNUEMOCSJOOQF ECYLCPTLPQJLRLSCUOUQQAEZHTMSUBVGMOMXPDDF UURZGITQWVQFWNHIBSEXFONNXWEYMVXOLRGAMADP CDEPJYBRRAPRWVYLNHFPAELWJFDDHZPRYTWYBOMV DFRFSNLQLWSBYTGNACNMYWYVPOGUJZCRKPQTQAOI WBYHYAHRPQYOJAEOQEDUWKJEJLQTNTSRDZVREMBB KUIBNXWUETRXWAPUBRQWPPYQHVDGJHGMZUBVNBZP LHGBJMYUXPQCDTSSFNACGBIYFLJGHWLGWRQLXIQV GEHTNBQTMBDBADAUJDNALUIIRWSUHJYMFRSQMFZM LKIVHEYBWWTRYIOIGQOMVAIMDRSTWNGGECZUHJJA JTLPHNZQABNRHJCHEFXEHHZUAUKYSGPAAMAHIECO DSSYWGJXZGTJWRZWCMXKOBCRPRZAPVPSWBBMEIMV LFIREUQGOEIEUBEUVTKOBOETFSKNYYZCFLKCJUSV OZOUSAHYOAVXYUOEWTUVIFUJHINTDUYVWCCJVPPG GYGZMBZDHTUPUONBUKQWGVMEBWFVMVFCDGDPPCWM VRVEYMWMXOXIEFXGFEDOTUHUFLOJXNKDKXWRCRFU RMURSOYUGWFIXZWNRPUWKIENJTKVGZGPWENXBBDM QUVCZPOZTBGSRRWKJLCYKKJCASCXESCLDNPOJFQO EIKMVCUWLIXTVYVUSTHA
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ZHEHUGRAZTIIDYJHFUOCXGATSJCSFIZXDDBXJVMR UQZPYDGYEAMKHMKDGIIGYWSTYCYKFTYILSWEIWFP IXEPKQFLCNNGWTXEJBPZMTLJHEBMYTDWOCNTKRUX GJLGAMLOPGOJNCTJVQQUDJIQXCCKLEMJORROJPYJ ERDEFRITEDDBJSQJPAKIEJRCKHNHRWFYPENJMWER LVJVPNXSIKYFFHMHUSWBRQSPIYCKVKTQKBCCVJVS JLLKZLFCMHOQXZVEUVHVJWQPZWQWHRUBYKVFFXWQ TBOAFQYMKKQIRPFEHUNTRYNKIMEEDYSMZIQHMMAB JBAQKXOLEZCINTHTJOFGBAPZXNEUFGCRNOZDTZZF RGAZBUGIJQZKPODXIDDLGCMZTGMSAHTNRJDSBMCL BVNNFOKJGAHGCZZIUCBCQCIDRMIHLDQIZYTZKYGC BCVGXKAQYWCDEJSDAHRIWQQTJAKMSBDZSOVISKNJ GFSKGIIEQIXMUYNLWTSBAKSQCSASHGPJZDWJQBRX HEFPATKOTGRUIRILQMKEEYZMCNRVXLCDUASWHPYC YFTKGQDPUKEATUXQEHJPTKFDBJQJQFSYRGRNECBE LCAIZFWICCOTIUQVJPBUXDHODCTXZPSESBYWXMXT CAIKCYSGMCGKTCBQZHFQOBXJNKPATABRTXMRGXRC TUOOKPXQSPGEZIMZPBLDBCYBPVCIJLXNGPAJZVZD YDBHVJZBYOHTGXHNKNGBRMKMABWZFBANZNPZZISP ENRBIPKYBWRYSQPHUIAIJVUYPESMDUMLMIWYHAZC MOBQNHVOBHLKAYMJFKCUKZRJKHLBMZWSFTUSLFEB DTLNMLJBYJTKTBJSDEPLYNSZIPLDFFGROJEBQAIP LQAUYOYZVPAMWBFNPSFMOXRSGPUWDMYNOIWLNVNO ZRVNXLKWGSYKFHVAGOKAFBNNEOZNYBURUFXJWDFG TPBEAEFUTHSJPIWWDDCEXYHHKBYPTVTMEGPBYKWS IHDEJLKQHGMUCKFKMNLWEJXZJTUWODLJZGXSLEWX TDUXFRBPDSOIGPLVONJNXTXFDPERCRIMCJWWMGBV EDRGNZLHKBRTFSLQEOGYGFUHAJWHVNMGSYEFXIDS ULFUEIHDNYPVCZDUPZMFMKMNMOZHUYCBBCSKEGCM ZHCHFZSANXBDEXHDGFXJOVRNJFUUDCQFSGKPZHNH IZRUQNJEZWLXSXDWVRITWFEZOZVRQFNVDZQDCMXS MJGKVEBORYATMCFRNIAAEMHLBHQOWAAQWWXLPUNP SRSKGQUSDHEFYZOVVXATDJPJMMBGELBFZUJGEOKJ WBEKCDCRZFDEUQZJHSKOCVRMQQISIBFJIDVJLXLR WCHDPJPGPHAAAXZZQQREQMRVWVXNMOAIFMPAFVCW IYALKOPRJMOBGOTDDITEDSQDWBQYTFGIEKGINPCK ALYMKIXCTXBQBRMQGDQROAPAZMOMPNMSZGIKFYEB SJPDIIERXTVKJZIHRKDOOGBTKTIRWMFBVBTNNFMH PCUFFNMOZZRTSMZIAZEKHTTVZPBSVQWXCJEQPWKC HESGIWWOBUFBJRUSDWJEFZGWVRMLUWJLRAENGEJT GQGPVNNWHKTVXLTMDTJTDHXXWSRXBEKUXNACVCEX EMUKKGHGAUVUBCVCCJJXHQXLFQYYXBOYQMKZAKZR GREZHNTOOXAODZSEHVGVJRYIDHIHYGEYCPWEBIYZ HZLPGPESLYRYNSYBFVIJIOJQOEEZFJXXKQUIRZQO UZAUVOTSWSDENHRMAOFMCYUQXBFYVAKTSWUZZHEK TTRALFLOUQWJQWXUCJJOOOPTVGKIBLVLCHVOOKUH LILLARCGKBWEYXBVPTGDKRTSYMWOXKHKJEHAHCQC IGOOKYOZRLQXXXIWICNL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      VDKDBDXXZRWNNBSIZDJMXACCKCVUWBGETGWAZVQG EIPCKBHOSRXEYZUPTGAHSZQMZZLSCUJMWRPUOROW JAOYNFBNFJWHKSLVFVENTVXBHOIODPSMDWNCKMBE VBJFTEOGHHDAQGYAAJUEYCLZVGZTKWHYBJXRWAFK SQXNOBWAQUHRVRVZVMYBIGKQRKJTNMHKYCHAEUEJ GYMDIXSEPYHXFHKJHYNHDBHFTDLIYXBXAQGRGZLX EJRVXRVKXYGADELACPVHDCLNFCECOJNNTQLWFIXT YZAMQWGEFASQKMOJSQUCJOZBUWKSLQMJKPLGVTJF PREDPZKNYDZICNXERGRSLTGJJRUVRTCWYAVYQCRN AUEMXRPGNTDHJWTQINQKPHPRRXHLWQDRXNBHFUMV LPOFKLIPMZLWOHBIGBKEPEQBQYJTAJQUKKFHSGYF TLIPTOCGWNYQEXZZXNYPAIRCGLXEINQOGUXLNTMC DGPGCWZEXGKPXWQOXQORLMMEMNALHALNUWLVOAMT OUINNNUJTRIVAJHMBKBFPDBTWHYHKZHYCIJVEDLV JMMPQKGYPFFQKCXSRBPNJJAHECEKQTGNLMVEYLNB NSPTRJQYQQFFUGWUKXNGVCJUIQMVBOPOEZQXMAZC PMQJASGPDUZNZHKJASIKSBAPEAEMBWCUYZZNVMTM TNNXRGLINYTDLONXKTJVVJYJMHKTLNYTSSKFGKLG PQXIDPEVDMMJYPCUFSDXXWKNFZORXOFDRCLXJNBN XENLUGCAOZYVAYXOPDAZWREDPGEQHDHQWGXSKEFD VVAQIZEVBLRXLVRBYYLJZHIRJRQKIJFTYFSLTBDB WMSGGQXTKIRAXDXNXPDDTNCZGVEBQJXRKXSIWPGL SHPIZCJUXSNKIBFOZBKOCEQVOZYUGQNVSFXXWRVH KPKDHFEVGFTKOUDCWUNHRQNEYPUBYOZYBBEDXFST EMTKCJCIXNXSOSFFSRBMZXXASOTZIOOJDWPJNJMG ZCANNFKPQDOSWYYZOSYUNJPZRUBADOICCPYOUCSL WWPOCXJLXKEPBFMGZVNAYHSYBTTYRDGOEUKYIAGG DQDSBQOICZDWJMFQTIJQJFHQKYXUSEFSQHPCTCXK VWIIURRPSBZQGTRMBONGLGQCXMSFNMONPAWRRPDM ELHBBVEXHRSNAVMIKKVHQXLGNZBPJFARJIOFWDFB NEBATHLFNSABBRWDTEKTMJEIVJPULOPVAFGQOYAY MTZOZVUMONZNAANRVVYNXUOICSJYWVHUIBSSYYRL PTPMEKKRMCZDZTNYZJOIENKGZJSDFOROSORTVSWD VAAOCPWCYLAEIAKPHPUWMZESYDCCGUSVQUMZKWHE BDTNGMULEJGIGHHXWHQJZUGJCUXHNPIDJZPVJKMU KCGLGBYOUXCPHQDSBWWRHQFPEDWQJKMWGLLPKITY SYLMLPMZQRSOKSFQBKBNGXGSCUDOVFVUBHBCHCUN LSGZHGFWDVXMTIFHPIIVHPYHBTAKDLKGKFPHIGBQ HHEKZYULIGFUWKVCFNPCFDIFOFCEEUTURLJMQXVE UIRWOCWVBRKREYFHQHPOLCNHHGBFNUHZEKHMTLIP KJMNLDFSVJZFYHIFWDFYDVJTBLUQWIDQHIRQKWQS KCMLAKGOICDKCZYIWMEEVHCPACFBFXSPASXTNBFO KQWNNBFEAVGOWRWPYSFIBZTZPLUUMPCVIBFCHTJO FWIJHLSFNRWVSUAQCNAFLHZAFIXKJBQTFKVMLFAX XOGOISWFZVPKMWCJXJAWXFQKBGMWDSNHYOSKNSNX MEXHIFLSEQVMUCTBQUATHLEPJACYJIJNSSOELAPP CYZXSGBVNKSOOJDMGWBFTVTJKTXZCJHFDHTDOIUB JAPLUCTSMODITMILCUIA
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LEWZITIBGURGCLWAESTOORBANTJMJPCZACDICDLF XNGIHGNZOVPSYKKMVKRBYVFBPVFMOIMXBEOPWOTE YHKOJWXCUXVFGRSWBTTGWYAOVLOPFBKTQZBSPTTI IEXAZYRXMOUVCZGJSAFOGUAVNXNMXGFMKXCSXPKD SSDGYNRVRKCTNQUOWMLGENIGIPXFTPEIEAHCVHCK MJXSIUFTECAAKOAGTRBMAKZZEJEYLDHLKONGKDYB FMZLTUQEIGXXCPGMSLGQJVXQKRBWFDQHWUNJNWUG GSRIXWMYTEVZMBQILYZUAXJKRVHOCKHPVYKZMUOL ERDKUWNCYVVNRFNXQPLQVMWIZYIBVPGQAGZUAZZV YVUSAMSJNUVPTTHCKORBRXUFZBRRJAAUHANIXGNC XCYFRLISTFRSHETHEUGPVJHNSLNSVMQIYJGAKBSU TWOJGMDXKGZKOZMLOVTEDWLMRIHVPCKYBEZILLQQ YWGYMAOALFVKSPHCIIEGRUQIHVMPDRFWKEKDJSFD UCUBUAVQKKPTNZAHMBDXECEIHULANEDNXJWXLPWF JUABCMCWKTOIGNYOFRGTYRDVGULEVQIVPUQDFUEJ JRDAYJIEOQAOXXOYCRHXSXAKIWKAVBAWMUZPCXRH CVUPHHQHYGKJGWZHRNIBVDQYKIDXLIMLVZPXEIZT OEUCUSLKEKIYZKZFGGAEFVVSOUGRXPXHLSSINXNJ FUXVENXWBOILWHLKSRIIOJKSHJZRWLNXQSQOTZOC GHQFZMCPIUQOEIWHULAKNGXOOCFTIVMCZZXKZMSH MTTYOXMNAEZJANEFAQSQIPJZMZXHEKYGLYXOOBMV OZFNCCEYEYERZUHRUVBREUPQCBIYIFGOMUYJLTMM QGGOBYRHBQKTKZXPZTQGXWTFZCTMZMWRQJEANZSB OXZOXFVHHYDABPROOZZEFYDRFZJNXJIRJTKYLJFD UHZWWGUBMNJXYOSJEIKPXBXOVASXAXSOAFNHIGHU DNREGFITADBYVUZLSJXJJSQYQKRPMCYZOMZUTCBK YIBFVIUBUWMQWNDPCDHZOXKTQYWLHTQSOFQWXQLG ABFNUQWDHRASTMEIQYGGGSHRDJCBOJPLDGOYWDNO CRSDQLKEKSETRUXQIXQOULSULAFBSCTCBEFSYWXQ LWRSAIQOXZXOICNLMWFEBZBCVJZYFAJYAYPYGYVG VHWNGKNPYVHEUBZQRJMPCCECOZVVWRJODETWMEOU AJQGFQBQWCPFCDDKAAKHTPWEEGEGEJFPUKAZUQWV GBRCUEGVCBJWMUHLNMITCTBVFWNNKLUPLTACPDCD SAVGLABFBGLBRTZALJILIXGULOUEMACLCYQWGBRE BUSYRJEFROMEPQTRZTULSOZMJQIKDMDOISNOYIMA DCHXDUJJZJMUEEEGFFIYZRJQVXMUGGTANARHPODW VAVQWDYXKNVHXOBWWGHVPWRBLSBQPQYXGUPYXSFZ YPITPZTGIJHJMMWDWLOBXRIIWDAPOPJVLIMCABNY GSXRCGRNNWDEVLGEIFAAGVBXDQUOSPTSSOOGYEFI PXOLTJSRELCWGRYVVNVBBVYTXJFWGLBAVIROEWBQ HPJNTBKSTKPNXWDWLTNHEBJSCYHNBCAUJKSCISAT CLGULWBEUTUBULHOZTTGJXTDRAXXIVPUZGEMYDBW GLHXHBJWEGPFXSNJOTOOVYNOBOEAJDZAWFARNACV NVWCIKJSDANWLOCIODIVIFDQXOAXHYVOQSKBTQRS QUUQCPQCXDCKAITMYPADPLLHRRDFILSVLEMOQSHH MCPCFHVOGVBZIGANDSTTBSLNYJTFOBJLAOQYPOUP BROPHBVHEMXJBYWMDTINGPDYKIPVDLBMXTBWPFPV ZSCWHMBDWKDLZUUYNCUU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DIHJUUTLSUWFLOTFATWEDXZGESGUFTWVMBTTDKHW UTSUAUKTJRTNJSOAUVQMYZSCIJTLLISCXYRPXZVE NTUNCMRQIJZVZUHYFTEADWFDRXTUKOQMXBQYPAEV KNWXOOROIXIVBOMWCRHOQTHJVGPPBEINFVPQPQNK GXAHRCOYVVWCBSPJXQWMPSQZYRCGBLSYQOMEHLPF SQFMAJXKWUZMYJHBNMYCFGKYGGYYMRTUROFDABET NXSPCINCULMUCJTAEIGHFNVNKYSIAZDCSLTAZGYT LPHKPLSELFMJLUIPUKYEQIIJSOPGYEXKGJIKKRON GPDMENAUERQFIKOXZGVVWHVVECUAPXGGSDGWCZAI ZUGSONCBIBUUYLUDWLKAFRSCTWGWSDKRQTWKECZH CSUCDUUGVUSQBDEYJEGTWRCSAEHDJKGVQDBVVBFK SSSAJHKAOJXQSHBYPRSGGGIRICNPWRHBQCYFSZAS IZBHGPHRCYOUARFTRBFWYGUSWIRMGMFVVOXUJYGC GGUXWRMQMRJZQZTUZHBPZNFTLYZLKMBDBMUXLSYF NEQXSZETJTODSRKYQCMVHERCLQAADRNDAVLJEXLV UVHCMYXIEMAXAMNVZZTHIIYVVBDWOMHMEFGPIOMR SDVYXNPWUKGJNGSSXHQWDONNQRLDGAVHUIEALYLX BAPRGWYZDRJBJEUKTJZVEYAOLMZFZSYMPPLSUHLC EFJJHEWAHJUBJMVXHSUMTIKUSJYZSGJZARHJAVGJ MCJSVOALKEOPCGWXNDTOCYWCRCJMYXSNCXCILDGW HBOUITTTWDIOTSCHXPNWZEGZOPXEEWCRIRAUQUND RAQUMOJDTZFFWVUULCXFTAPEPXJNRMAXCCKVKDKS SVUEBEYJDDOKBZFVMZLFUMUSQJQGKHYLOYKJNQCV FTKWGCMYBMANOJAMXKSZKLLLSIYTXBTNHDAUFYOW TWFZKWPJFEJRGBBBGFIVCLCNNXQXTLQLILDFIESX KUQRUJGJBXWNFRLXDDSOGCTEOXPPUVDMOOBJVDCC ZIMAUBUBMYTSQUKPGMNLOFFYWUPMCJOCKLINIZIE FNQLRZHKPLKBDFHMYCEZVJLHPVQWBIMSYJJOSJJV ENIMWXZENCHLBHYQYXPVSERUNQIMXHFWJSQWYGEO ABQNJYEYEQPWGOEMAVWXXIGYYPBTGHUAVQZVYYDO LMFSYAKBUMBKLMXIWXJBOBNEQPHRBRKMZPBGOYPV ZIOFFTFRKFFDXHMGWSWSLMMTCPNNZMCTFWNNPETB LGSPVDRTHEWOGVBGTRFMWHWSLZRMJGCHUYWRWSLN SKJLZXWPLYRYGDJFLGQDTBGLAUUUZJOQLTBJAQKK BUFCFRGIXYYTDCWJAJKRJNFYZVIIMUIOYSVLAGMW PWFQUQUEJEJGCCWIMUNAIDOXGIUDGVGVNHOQVTYW NHDHKZGIDHPHCTCGBMUHEUAOLNWHMEUCFJYKHIPJ SOXLHHGYRIWNJORXNHKEABYPPKVRLNLQUFSWTSNX ASJBZDJTZJQTDPGMSEICGRCIMNMPEXFEVCBZESWY KYQFLEXOAYRJGRPCILKPKREWTNHTJEPYNOJYUXUI AKCUABVJFFTCBQMUZIJYHHEYYHPYQRWOSQIOKMRC ARBWDXWIGEMJXXYKTCLERUEHCPXWMHTNTTDBAHXQ UIVQZBNHWUJQUYAYVBZEBXMAKTYSHGIJZZNZUNMB HLZDWLGEBDOJRHKGQXIWTQGXAQMCBCOZNUQOSXMA XXFBNCAQLGSBTZRBSVDXTCVEHMUXURDJLPDBEOKT UODNCSCHYNULAWQOKBYKVPVTTHRHRSOOHACJPXDX EYJDSDFXUAMVKYJBWFXXQJYTVRCHQKGYZQTPWYAQ QCRQMRJJNZRTEFQRFUET
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GVQFPFUVNZYLTVLGSSQDAYHGWDDWPCRWVNINPERV GRQXSUOWPQJXNQKBPFXRXMXIVWNMAASFKRTJXASL XBMPXLMJTQKEBEXUQXQFRDOGEEDPBVCRBFWSJAGU XRGQYLWXOIMCLIPOEDLLELQJPFTNFIWASPHYVAER GTLSJKUWALGKQLFVBPMKLDNDJFRDZIEAUYCXGHWM CQRSOWGQAGOGUSSXICZLXAWOOMKRTJXLXUCQORHD YTHGEAEEZRWIQUGBPECSKTINTWBQQENASTHVYTWR VIWTPFXJWXJTFANXUQOYIIYCQPNQOMEQJRPATVRO ZAXIYTGGRVOOVCVHGAYVGUSDTOAEIYEKNSCVRQMT SBPJOLIULUUFQPFBWVCPHUSMBURXLOCYGRWNZMCV ENJKGIHXEFOQPLATOEIEPAIBIHTJDTDQHXFWLODY NDEIPSXKUDLZNCWBXWHEYPQWVUFMOKHEIRIYKWKF PZMYBIKYYIXTRMNWFRIMOXCGJYNYKQDHUBWNDLYP BIYSILSQHGRRUYFZWUKVVBRNAFZGTBDKSDYRLPAL DQZPZXPUIANSAIULAZTHSJOVNNYGUXQNLDCSERCA AQEDCWEPNPKTGUWDSSCQXDOZZWLSTVGYJUKAVHPI CONDQEOVTIUCJGHYUTEZIATOLKFBMIKFNSRJZCHR KABYEBALVCFXXYCPCUJPIPJYGCTNYMNRYXADSOVM GUKNMREJXJDYCQPMJWKQMDOOSHHWEGCVDUSZTGLR HWOPKYQAGSSVUEYPBJLNNYXTVFADHBTBROMGNUVB GHBLRZYQTNOLGWUMAYIDVFLRBNKGPHCDIXQRVKMH DNHQMKBDQKOVJWCZZBORXXEDWCXNETRKRBKWIIAY CWVARJKPFHNQGEGHLNOQVNKZXSYXHSGYWGXWJWIN KVMIUFBRDSJAFKEGGOBOSGPIVAQAPORFWBQHTSDX BOSOVDWMTXCOUDEOGWVLJSJSGUDJMNVHLMRKTZWW MNGJUNOBFVJTVLQXYMIJMGTRWDPSXNDSKEESJJCM JMIRHVDMLWUUNONJRTLHDCYOGEYZYJXQPQBTJHOH PFMEWAZZTSSJGHTCZKCLMQFZXGMINXRHZKISMQLZ ENRGUDALUEVVNEQPJQNEXMZIEAPMWXGYTCUJNDRG TPMRRFUEJMWBXUILBWPOGOQFWIXQSYHWMUDROTKL SCQGKZCOKWKXXMWUTIADNBUXUDZUPIRRBPCKYGPY KOVYSPUZOFEFETCTQFBKFXNXDXJITIBPZZYTZLXW CKATVFPOYRSTHBBVANHUJYFMUBJNHAUGQBHRCYVA IDAAXKFZEIOXVOLLSZQKWHKNLCFGFFRHBAYCZIME IBBQKXYLEQPIPZFOASDGLVAVYNSQKBGYQQCIXSAY IVLKYMDLWGEYGLLQODOJYUTRQKYJOGFVDFCHDPAA ZGCTFMSUSKSAYQKRYDUILHFGSUYUKNVRDHIISMND VDJTMARKHZZLDQMMETSNDWDPBEZDIZQYWLLULVNX IFCCBVKOOOMYVEELXBPXDYSALCBQGCVNNVWIYIPR SGUNPSXORRRJWVUIBDRNGFABBARBVJTYJGGHESQJ MYADCFEFDPHAPXUTPZQUMAPMJGQCPMSDNYKHKIQZ AXPRJPAPUYZPVGTTMWAVJYANOWPSDFZUHMPYPTCM ZTCYXSFPGYUHOGLODECNLAIKZMEEIMRFHUOMQABS RFOAPUUCJGVVRIBDZEXGFMAEWWXSMKMYZMMJLDUO THJUPVRIJICCBKULOXSLTVIAILTXZHIUDBBLLTLX WBWPPNSKLVOXUUKTVHWKGJUZVLFHXJCNGAOZEBXJ BTMGFAPUTDYCCUJALRQQXNHFUYDEOPMPKYCGDOGK YWETLYJSFNAUMQXEIOLH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SBVPMXVUHMLLKPHULHJMMAMDGLENCYANRGFHPBID SWDBCBZVFLGQLSMHHJBNRDRUQGCNEENOPVASOENT KVYFGWZRELJQLBFVTNMVOQUSMIOTYOZIZIVEXSWP JFQJAJBAZGREQFELSZNMAICJVLCFUOTBNBTQSIMH GNGREXXQGCHYQRLWLVRYHXKQPPTXSQICBYRPAAZV NADEIDYUQAVUWXONWDBKDAGBUGEZPAXBNOWVYKRP YYYMODYYSZBGDHVQDKQXVKODECWCOFYXPRZGNHYJ PSVKWFYYWQGRWTWRHIGBMFOZBLDXYHXIMMJZQNVR FZEWORPLAYYLEWBQUZEWFTFCYRNHKZWZSKSHGNOF VWIUUUJHVJMUYNGDSZKULAWNXCZDHPXRQKWQSWBG MLCAXVIHLAOGNVYIAWAOBURZDENZGBXXPJTRVNWJ UGVXVFLHSUVCIOXYASJOIJAGCJWZDDQSNXRJZQVZ SYPFWSBMLCPFTDXRXUJDNCEHGSUNWJSWYIXLZNIN SGWTIDTWEJJVKHTXNNAIWJOZAWEUATMWMMDXAIRN ZGNGQDQAFLZQOQOYSKLTXDTATYKZNASMWJHEIRGZ FWDSXYTMUBYEVPPEFZVTCGELVSQTNHYQFEGRUEAZ IRYPPOTIYCDPUMVYTRVJXJQFLTNYUJKPCKABGCDV MQVRORLMQBUIPHQHYERXTTIPWSOJLEHUYUTYTXVX SRVOPEXCBVKSSUUNYMTZPHLPFEANKFLGBAHCAWEP MZIWRHOHWBAZHRVGZCJOERSLDLLDPJHNQUXGZQJL FXPWQUYZUCHPBAKZKFCTXETCJGYBWEXTADYWCMRA QUIEYRUINFGVUEHTKLCGKWOZHDMJMLKAYIOBFRHF WVSWMGMNJHOOTRYPCPCMZZCCHUFVCNTGUAOFHOIT YFMRKJYHPZDYMVGNQJNPOIZSCVSCJSWSCMLZGCTU UKJPXFBVWAPRQARHZOFJQCEQFQQIIXGKQTTHZYBS CJERTJPCTVUCRWVOCDBCPCAMNAHXXZAJQQJDDBLI NXFECEYCEDVRRPKQHOEEBVKCCOZZOECLSFOEOYAB QLLLLNOWDYXYMONNLZAJLHNPHNZBHAKJRBYRVZHI LZTOPGEDLTSQDMLGTAWXKOOIFAXJDBSSYFRLMTPF QMHNVCVQTYQCVEGMWHDZHXYUFNJZJENCUYTTBQLQ MQPDKLTFYUKEMMBETYSGROMXBTKOPFYVGNWZPMHY ZOPYWMKAVDBXBAFXURUSVCBSIJMEJDAOWSLRGRKR GOVVZLTZUDMDHFLUYVHATSVRUGRWAZAIUYKIIYDP TGCKOBRLFLMRHULIIQVXLTLAJNPLUFBVIJFFCBHH PPCNSVWYTMESLKLUJBJENDKUFMMLDPOHYSRFEDHV HPQYADLJOYCSNQVLOTLVMLWAWTJQWBNQTHNXAHRG PGICYHRFHJJKTGNQVBMCFYGJEBVAXRHBVBEDAMHM KQVISJHALRSBKSWUJFROFSUVFUYNAIJVGRVSZHUP OQZAQFYAXPNLKLFCNYLWMGYDWPWPAKAIRPNOZQFL GKOERUJUDMNOEVDGGDMIMFPFOFMFMURSVPTDACRJ OJWCEXAKHSQXQOORCCYVTTMOYEOKGXIGTJCEQJQC INTVHGPBSHAYLNWDKWWOTPFPRAYFXJBYJFTCLSRE ZXSLIJIQPMLLKCPQBRCMJRGGPFUACFRCWFTGQTXP MVYJGBQUUMNKINBRLTUYKTHIISFDPCHKFCJUWVVG VBRPQDVCFAVKYPDOXDMMIQPSBVZLZRXECCLDPSYH KBKVNMINCYLICPPFLTVSSLSYNLHBXJDZKCWBURAK FBPFFJMBGFESTWYPVDWEWNGLTLCXSTEWAORTPSAT SBAVCVBBEBKTSVVBBJRP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QPGAHDXQMHSTSMREUDLLKHANIOREGAPNLUZHHWJR GGBSHWBIRPQHDRRCNTRUKBCFCTKDXSYRJSJJZQHR RKAVJPYONGKZKCJKSRJOCVABRZGLNWPGMQWXOEIC BZXEROCTIHLWJVLTEAKQUKSMKZDLZHNFBEENWBOS NIKCRNDZCTXBYCRTMXWJELFZMEDKRUCZZNNMQQJZ LRZIZFRDYKVGPOKIVXOEOOXRQBAKFAGFRGOHZWLZ BKBRXXRTNURELEQVYOQNKNNXNEYMIDCFVQANAPFY XXFSWACIJAUXQTDHPJLPOPXJCIZMYBSLSPGOCYVZ CYNQNDSLWCZOAVYRAUHIBWKCUSQEOGQSROTXHDTN LZLJJXOIQHYVKWEUJEDCBTBMWTZYSBIDYARGLQVR WADKOHKJZFSKUESNSNZGHFIYIWHXPFNJRXVIUTAZ ULRPSMOOJNAGQFPZOEBZJRBNQSYLNKABUTQFHSCZ OQKKARKXDGZWBYMCAQAXHVYOLRZRRQVSDVICXZWK UBYZVNGRGAAVMYIFBJCDWQRZFIYDSZTVYLAEGRFD IWSDSSQKDTGRGIJDOPKJOTLMAKGAGNKCKRDNNYTY IRGEMVXJALXROBBNIIZWEKKVAVUBNYFJZLPMKFUG ZFOXOZZOLRQSLQYRQRIFBSLCMUPIAWYQGIBCMGNF RGUWBBXHBLHLZINOADFOEPSIKYEFGLMWTUOFOZWF KVAATAGIFXQEFDYZJBIDBZBSHGXVHDUDSVNMEFNS JNGHVZKVVWMVTBOWIHAACUQXSCBJIPWSNSBGHSYJ CKBVYXRNPFQSMKKMJKOMJSVNVLXCRGCRHCDYSBGI IIWDHSIDJODNSUDUPJDNARSIAZMREKXRIZENWOEM KAFNBWCGDTIEZNLKLBXJYDRXYCUYWKVLCFAGVAMP TCVYSKLTWXMINGVBIZBRHMTARIWPXWKGTVOKMOIS EHJPRSGQNBUEMCUXAZIEZYSEFEWVALFUXNYETORX KQTEPWUZUCICJFPURVQSCVHWVJYUWGBSLAZYPRWU SBHUDHMEXNLLEYYNWWWPLYGDKGUHNZRGZRENTWTT QSAGYIFDZKJYWERVKRRSHQERJRJYNUUUFAJSFYGO EORWAHPVOZHEPTSRELCISTDOIDRQQJIQCFAOZXGI IZYCBXMNOJCPTKPWTZVLPCQQAEVPRTKLZGISDZNF MORUMDGHEQDQXMQYKSSMBTAGOPWYGSYOAQOVVQIK PWKAAWBUVNAJRMOFQVGHATRVIPNAZTADPFNDGNST MNLYDMEYKEHMWLTYMDJWZFZGDCDKXFUQFIPUKVRI WYSABQUOGNSJQWQABSJBSPVWANIKWRLBDXGWPHUO BWDWWCPGEVVDRYHKPXXMZUYNIDNWSDNCYNFAFKYS PACUSXEOBAIVJPAKHHGHMTMFWZUSZZQBUMRGFKJG YPFHKBGGAILGPXJEWSNRLXRDVQCMRZERCSQHMQFI IBZGVVUTKQCPMZSOFQWVZNKQWQZPTZGLUPVOLILN TZUYVVTFLQOXNBJLNMSEIMQQLHOTVVWGSQQWCFHD JKJFOVIWLMGNXSTOLBLPIPJSREHGPHYJZLUKXEQS MDPSNMRWDZFYJJBYZPVOLQOPRHFDFHJNTBCNPRWQ DPNXYXYZASCOIXJXGZLZTCOYYLLFTHVQFSRIJOHC OXGUWJNDVZYKRRAMMEIEUXEUTOOLUMYBJKVDAFXB RDZUEENLVSJNELDGEVALKOSWHFVSLZHLTIZHDURN EZPGFKLTVPCIYQSQFNUJMOFJDIDHINRTKUKGZMJT TNPNBTCPEJOFGJMQRYITSRMTACMTXLYZUIKUTODV NDAEFBZJSMCXLGGEDMHDRJNBDMHUKPUVZPQSZJVZ KOIBETCALMFQRPJWGSKL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QJSIDLQDYJSNMEVRPSKAYCFKGHZYTXVBDEIQCMUX QEWSTNABWDBGMWARLRDQNXTOSWJZOYZFIZDUVYEA XLSZULSLEXHJMDIHBPPTLFEQXAEHSJENUSRFSFFX LTMXGFJXKSTGPSEZNWARPGIBQRFPGUURFQQPRGGX YQRXSAEAEAPLXOELCBURMRXPMMUXQBMSYRGFHXIH VXHAKXKJJAMGKMPVWZOJEYCWEXMPHYFDKRRIXEFB WCGUGQKGNRELHMVXQTPLGHDAHMSIEDVOEPFKHYMB DSUTSLPLDCHLCGHQFXKBFAEGVWMIOKPCZJKWXGRT VNFFTUBWYQIZUOQEMLEBSCZMRHXYZNMXGIGWCXYM URJWQGJWCMIUWGVWKIQUZEIPVVDBNNZNDACQKZMD HCUAJIGZGZFKBDFJMDLVUCNRIOJFREFTXVRLIGHJ MMZSPZIQTBWOAEJUNYZOGUGXXJXJSPRTZMBJYEYT FRKJLNPBXAJKHFPHZYVFMVCJIOWHOGUXCNWCSLDP ELDWPHTTHNWUYWCEVKZQVZTUOMANFEKFZDFBSKFP LJIBVWTXOMNYCGCZBBJFJQARSKAYVCPYRAVSVZWW LXICYQTKKVHHHUXUFCNBRKGBEYSUESGBESISEESO DTUIXYGAXZRECKZXUHQXCNKNFGEWYPDMRDOPZBMA LFHLXVDTOWCUXWDDZEUNTAIQPPXAQZKPCUJZZVKG HXVHEKFZGACRBCTPAKFKTOFTGXQEFQZKBPBDWKVQ VISKXWEZWGGOIZGOAOMDVFHKZNKBEFWOMFHSZNLM RQRCZRBIHANRINMNZLKABIMDLGIKFBAIAAJZDPER TURLTOBELIWXLYGBZCAKXSOHTXRHRYHXOWWVZRJV QDJGUEYEZMUAPCTXXZPTGJKQTAXHLIALKSMFCZAZ TWJZVOKKHIALUGOWLZKRWFWCBAZLCJBYRGHVMAYZ HRJERESXIDQJJEVIKGABKDXBTSLXAMNJFWPXPGFZ GEDPQTBGLTZKMNCFCFWQGJFQRIZLZGFSXRCXDYOZ OXYAZAUGDTINWLNIRIRHTJNVRBGUNMLKPPFKDOFS CUMSPRSGYFGQSJRWUTVWQQLXJTDPIRLWQQMMQWDV GLURAQRZZKWUEXNJZKIDGZRYYGTIQOHKYIMQISDA XXTRMHEFTHLBUOFCWORPLXDAPNVTRFHHWFJFCMQS NUDKXSXEVLMPILYJVRIZHSJOLWUGWUZJBERIKNUC GUTDRNZQFMBCLLEIFJBUHIXYXMILZNLEJLQVRAYF WFQEFZOCMXXDWLGREIHYQHBIWYWOZLMYODPOSKNR XDJFXSGSASBGGULTEMTEPIICATQHIHJIXKCRKBRG BTCMOPKFEEZHSFPKDDTDLJKEMYETRBGMJCEAGQZD SKEUJRDWTFQGNCWJFHZBNETMVDOAMASWVNCFFAHQ WZIACOCILFEKPOPQJBESGMGFNWYZDLWUEEETGBTR PKBRZXFBQIWCQUQWXVOTQXZDQLXABQVLVKKCCYPY DFHBGEGZSLMSWCJDIWMNSNTUGBGAVCJBWBJGMLQO AJAAEZOQDSGDLRHCYHVGVKKXSSMFNJGFSTXHZQNF DRIQFIHMGAQURFEFWMSMWZFESQSKFBZNLWSUPRGQ YVEQJGHMPTVZQSHVVXZWNIRZMGJVNFXCHYAPUJDR GHGLJHQPWDFYFIMZZVOATVJBRABJSCTKBAXNUEFF HYMXGSESCQPZVFTHXBTWEJRPAWLXVRFMNCPEGLBE PKMWQUGZNHRYVEYQEXCKPLBMHJUOJPLLFQHTEFNH TYMACCCRYEXNNKAZFYZKNPTPFSCLGXBGXXMPAHKK YZZPDPMUOAVXNAGYSUTUUOCIFRCXWCLVEATXVFLG TMLAZWFCYPGPXIDDBTNV
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FRUXTENARNCIRHNPDLHAQGCZOYVPSJQMMDAFLGVD EILJCPYECSFMHQVFBXALPQOZFZAOPPRTZZXZZWDG HPMUCSYFYJMMPGLCAHJQXZAHONYBVGPJXJFFDBDC FNHOTTRMVJVCVTJUWTRJWHPEKGEMUHGBDNAIRKGR BXWTZGRFVFLMBRJLCPGIJVDIIXOJVFHSBMKIDPYR IGVWYZCOFFSSKEXTVSFJBLMRHTYOMYDIMCRJYVFN IXXMVICMBLNCOMZRKJXXEFGEKLFXRNJFZTOZHMSZ PZLFFSTZOXOVLYJOTBLUGPJAHIHBSEUKXEVSCOVE WFZXLCHETKZYTTXQLBDGEBXUGEACRQQEHPIIWTHR KLGPRBXJMDLDKDQYSGXXIATAKNZXAMQJTUHUQCYE UNQPTFEMNVGDDSZACEGGJWIGYDLRXTROCNIYQOMZ LDLXTIPZXSYZHKTABURRJQKAPXLVMGFTBVYVXBAL UDRKZZJCADJFLMKWBOVCXFZFEQJLWRFNLONNHVXK YPOASVNTPGRUEIMEJGGCUJIMLYNVVDSYUROIJGPR FGRIOSAYGYVHVKXBFXTMUIWWSHIJIIJWFYLRNFOD CLBESDZLIUIZIPAAXEIOWKTOYFDQYHUJTOBRJHJO MBGUVNWSXJDEBMYAKHMFMTXJDLUJWVJDNFZUODON EGOJIYJSYDJJWAWJVKNSQSDIZGALTKYDIATQHPMF KWDVNESIQLSXBGTLCZFTOGNICSXAJOYCJSYXQQEZ BIUBGPRFZRQKAJJHPDULSGPETWEQSOUXRLWGCJTS GSDTFWSEXDZTMLIVHKDMNWIEPDWAIVRPGYEZRVUH LHRKTJCZOUDGESVGAIPIDYGVZBWTUSZADSPUEOSC ZKWFTWNJOQSOPXQIOQCTNKJVHKCMWQTDSHKLVPPT AFYONEBRVVHUZXGIJBMUFSVCOXDSDUDONJZXCPQF YCZYXUBYAPNGSVROBAVHMBGSHZKZIEACFKPIGDOI RXCHFDFLXBFRSCGMATPTTTSFGJUVJDHGQVCUVRPB QYHARODNAJMSZSZPPMAQYWQGMGBYEPCOKMQGEOQA EEMZTETJKNOLTVXEWTPNIEPLHJDTPFOAJMPNWRDD DTUOZRLBUVDOWEMHTHNCQONHWHIZYJGABIBGYADC RAZGJHLBRHOODFNBLDDMTYOOCAODUIJZJWPWTQSL OAEYMZVWBUHSQDKQQDGAQKLRMNFBXIAJUVELGJID QTHHNRWACJPANYVQSVIWJLGQREQMUYBQZAETUDCU AGKDKIBEERFWBXLBUXDJNZTIKNLSKHPNHLTMENYV LBFMNVFDTYVDHUYSBXFDWANZEQHVMFWUWLYSYVWF SSBTRSDJNUUGZCYGVQFVZXQQHTXBBGUFMOJSXTIS OVUCRIYKNILECDCQGOSRVOPRHNFIAXPNJTZMXYTT YEDQWTCSWVQVBGIUSCZLAJVQEVXSLSDAVFDGPGKG NDICKOHEHAUYUYSNILRJGVGCMSWVPKHUYGYDMXIU QQKCMRNXHBEWATAAHYCLXMRPEZMJVEGWBBTLATIX NMCOEEUOPMXWHIUYPFUNCGNDVOTYTOBRBUYHBRTO SCDSWWWIXGSFAEVIKRCVFEKVZMDFEPIPOHRMKUOC NSECBUGMTGQUYOWUEYBYLGGNJNKHNPDSOEVIOYIQ RWPUANKWEUUZTJQPGCZECBHWWYDELFSHBKNPTGWE GUXPXRSOTCWHGKUNJPPGTILPRBLKIVIHAXEJXIAP QXIVMZLWILWKOQAOIMTEUNRCLYOHTAPFCIOBSUZL FBIMSAGFPMOVQUFPJSSKHZIANCJILKVOZZYQFOIR EDHAUOAEBVEZRPKEFWJDQFOYDQLYAHBEWODTYEFB VCZGHXFEXMCABUBMYLAW
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LTPENLXNKWCYGTZKYVCZMYPJBFODWFMTROYNXWFS UOQIKDGQNORZSKLZNUYHIBHDDYHFHPLLVVMZKEVN UCJNYQPRRBFOSMRCVSOVJUJRXHOTTSTRXWSRDPTI AQNMVTYKBVVQYFBQQPQSDHHMXQCJQPVTHNHFAYHP OLWFFVINUPNSYMCUEBKTZATKJQZHEYFTOAWEKAPC XAZMTJEGEWKGNFCSNNURZQSTNTMJDONDAAYHZHZO CPBYRFJHDXAZMDAQLELAEFCHLTDCNZAHMWVRGJLR GUJONUHBHJVYSTIMCNEYXZEIWVDEBEQYQADKBPKY DIJPRLXTGUKCUKAMYMBQDSTMIKLYXSJCGILVWUGT CMKJYVGNJYFXLAWTHQTTVFYDYDCQDOYGGALXTTIO TMXQGMRJGNVOWPZYZKWLVFGXWYQFENOAKXHPOEJV HHCSNMHEQBZLNTMDXYCORXRBZFTWQDCBYGRDVYZT CVXKCLEZCOZSSWHRALYLWLMPWEOCGYMIIBCGTJBZ OZCYCNFDHDKRVZIGAZDDWHNMBHXVZBQOWRGOIBJI SYWPHYSABYJOHYYDDLAFXIKQZJTEUFCEUTMVQUXS VRXNWZDTALQODNXFQGAIRSGFXMYIITZIKAOEBQXC DINSIFZSIMNYFJPSGOIRCIYERPTJAUZPTGUJIIWN LDFZCDFAKUEXKEKGTZZKLIFGPHMUVLEUTLVJHFOF MKZVBVVQBZOSHHAWDYUZVNRYGKQBPVMEPHVVQVDG RKEUCHYTUNFZIMIRIGMLDPINCAFNMSHITTDQCWXG GLNEUJYXSFRDRTXYQCHPFXTFAVGMXBBYQCCVPYXN GLMWRRTTAUEHDAISYYVANAMNTCYKBTVIADHPAWEZ TCBTRBUESFCJMCACRYFSMBBPINHDXDVXMBGQFRDF BIIYJRGKCOAJLAKCLJVACYGOZRMAARCKUROILJCW PUSUDSEPSGBTDXOBAUUMPJLQMJXAWUIFTTYXWKTU QUMNFEHYRANNHCMMWOKGWABGVIUCPBXUPKVBUWXM TAFCVFNYOMNRHWDQUXRTOHULWYWRKCONLPEOEPSU ITEEQDVUUBUIWAYJQZIAOOBIMRZTKHIBXECNWDPR IYOAEKQAMZKDMRMHCVRCYTYJWBNXEMHXZXIUAXKO VKTPYKDUOCYFGHWPUMSAJFVHKEKMJDDNFGLYLEBM WBTDPBUENHPAWHHCRJMYFPTBLRQEIRPAXOZFFQOS WKDAKYJSWKUAFBFNQJLBRPAGONDXOFGDMEIZJFZQ RGSDRUKCLUVMFRCVCYABZWDTOPXMLKMMUULLJVBW XKNRDZGJAXQNSNIYDTGAXKBZYQPMKNXYREDBWCQW LKXCBHAYAPIGWHWSWEOINGJPQVTLNULYQGUFOREY CRAZKHNITGQUTIBJSBPEAKIFJVYMKFVMPESWEVWQ HFPMNPKEAWKTLGRWQWFBXFRUWKRDCLFABFCRSLYE SUSNFTILCJYQFUTNENZWRSTHBSOYGBRPMBEXGHYY EHJWTYFGGKSFKEUTSIBIZFVYHHTVNOQXVNRAEBRY KJWJVXMWMTJMKVZVLMZURPIVBAMDKZZTCGDSKVIZ APCKGWTFHLJNWWYJVWUSYETTAWTNVLFMXHXLLOUU GFVJBWXOFAAIQXGUWZRFYXUFAQXABHKQYQXAGSMU MALQNDZRYHBHBKVPBVXFXMTCWSNVDGEDQBFQLESW PVYFPAAGZZFADIMURGVPKFOVGHEVZELQQUDJSYVQ AGIKMTOJVCBZMRCBNXLSHBIBJSFZAOTAQJHKNRCQ WCRLGVMIFEJOTAFEZPNEOYMIHPRQGAEOHEHDGOVT OHWQUJFRTZVTHJIXQTIFEMQZPUUENOBSQIAACQUZ BESUNZDTMRWELOZPEFLP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JPCXOSHFCNLELRTNQNOQVRDNZWSGXHFRSAKLNLRI VHKIKCEHKOXGHVZMBURTXPFNLABUMJNTKQRKKKLP ZJNMNIAKVLXQLBIEXRPGPJTGSPYKUOFOOIBUIVKU MNQHSGULOTHEYLQRGYZQTLUZWBOLYKTKCLYBDPFV MCVSBXDISXTWQDZCALZCBXWNKYRGFEZQHREAPZIQ HACDIDPPKUTXRZCUCIAPVQABEUZTCMZOAESFGHUJ FLBVGGJSQHOBFYMJKBMCKRXXMUTFLKHRSVZHLZGQ RAUKCJRERABIRFRAWKAFRUYKTMNEUHAWHKUEFLZR JHXWDVWAECJIRLRJGCVZSAILICWYHNPEYISWJAQQ MBTQEWWCXRTIJGIDEDUIUTQLGFCOFAPNQRBYYZNX QKXVANPFCISNABRHSDVZTGMRFVOPQMOVVTPMCNRW PHFNBODBZXVAZCDZPOZVGAJAQQNPPONPGZXMUPZD NFUBLWJBZJIAIVYMZZSNYTJQECQLQWUUIOBUEAJD YPUBHXJKFGULUYICDQCLNLANQZHBLOLLEPFZXASM TOMPIACXQOCHENKVJWHIYZZYNVXRQDSSHJJFAPZA XDHLUUXKOIZEYOBFHNNLRBWHZGRHRAAYSAGWIOAK EIAYFIKBTKKVBXUSCSYCUQVIJGHTGOTOUGUFARNC XRQCSJIHXEZNHQMGUBMPMYAASSQDWJRSCCPVLSUC EPYWLFTWGCSYRBUXOKLTLKAIUMISVMELWNVFLSWR QIXMGJFJDOCHAVIGJPDVWLOBAEQUNVHPCDHSPWQF OPGQTPSVALJDJGWVQBXUZCQLJJETWZZWBJUWPPNW LZBKLJFOMDGZZRLWKTEXQZTGLKQBDXHRVBMUIWQO WFPJRUDPLARHNTCPPVRJHMQFKIRHTRVUSYPDGIGM ONXWHKLDAIQTQHDHJSZKCUKYJOABTKJHUWQVKFBL CLVEOWPGZEMTSMMZOUTNPHLSTECSDPOAAGLPOTXL LYVEXVHRQOHGPIMNOOOIQZUFSARNFSBBZSVQJMWT TJAVNRCJRWZGKGJBCLWPJHLXPGZUPPLJLRVLVCQZ BRUMSXGBQMEQTRRLAVKMJVASLMLLUUWDNNCXESYU VGQKLRPDQYHFUHHZDQBYEWOVFXHVWOOSNDOXSHYY YCLPEFVOYXJGQJZRTYTXCUBOEFPNBOATSEZUVUIF JEJKZGOHAHLHFJGPRMFMLCNTTPJXGOKSKXZTGHWK NTLXBTJHROXZWHNQTUWYYBSEWNSLDZUPRECKPMQQ OYJFOKSLZGOQUPSPPDRPIKPOBBSMPGPJKLPVQKGC UXABUAYJFAKHQPINQYPJVGVMQYGLOAKAZEMFORGR PBOSUXYXWEKLPAIOYFOPJISABQVBINQOVSTLKUNB UWEPFAZSPERCIPHUKHYNITPAVVKXLKEDUGXMSPYC EZLLXMNXVGMZGPVHYLRREUEBEENLRKKAOILJJDZM TVHCVFOBGMDZQVLUVLXZCTYOJPFXCBGTYDETVLIZ LULXYQVKRUDVXYDZXGUXMJDLWSDIMCPFNJWBXWXK MOKPDGSOYYVVRPYIDIYISHHSRMLWZJYKCSJIIJLR BMOYEHXKTAXGDIBHRMSMQHFYBZYHEAIHEICZOXQB KRPQSJGNMGPBTKEBSGACMMNFTIBCJTFSFMRDBCCA UULDRKVAJTEYBMTGUGEZEAUVPGKRXEEBYLFGOZVJ EXLSSLVWODEINQUOTUFHHFKQUFCJWAMBAQGEXWFY FTUAEUOYKABVCWDZRWPBWRRBEYNUVWVNDDKXRSFD ZAHMYWPXEOFRBVVWEPWNFTTDNOEQTRDXGFUTKVYY HWNQCFWTRMEAXHNKPZOKFWYAANIOXXNYROHKIGSP VFFZOPUHNDTTVAERJYIF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      AHCRVXCQZAOYOLPJFDIDYWEHPQDKHRIDGTGRNAHU XDFYNGDMOJPQSMXADSXEDTOLPHXLQWWSEORPVCEN FNIZPAYAHOQERHMAKZTNOLAPSLUTUPBEWOPZQELK EUDVDUGNFFSANNJHBILSQXRIYEUEDVBYAYJVQLJL TUKYEDYAECBIVCVYDGIAESSSHTMDZNTAVNCKMUAG RIRMTSUIZFAOBJUQEYJSRHUAXTXLHKBGKYLCJIYL IDXYLRYYRTUCHPUTPUVIJKKXYNZCJJUVPHPTDWZU KWMTEPMIBSTVMRJWLCDUJBBSWOXPSQQMIZZUVFOI PQHFPDZYJWBAGNPMMHQRCNALNNESAYQCSTJXILOG CTMLOYQTRQSWXLCZYYOFUAGLGSRQTZZYQGFPAHIW ERWWLENZNNFKFNCRMJBNAFHGJYXBUJOTUKRSSIUW MKARSSJVXNYEUBTTTRSEJMHPNKFMQUSLQSCMEETM TOOKEAHOBMVEIINMHEHWLEYKSETGPFVHNYZINJIQ OVFCSXQDDLHUERNXSILDOHXEHRCSYANEWKQZNQRZ IIFGBRVFBTGIGULBWJBXGPZBTWMSHOFDGARTQQIO DHCFQSSGAMWDTZIPUPTEFUOMMOUVICHPTUSLILOU YXEBYXHLJJEOTNRZAQTIVGEYVHZERSHMAOZCIJBV BYBMSBLJEUGJTAQIGIHRLZUDZSKBEEWYWBXDNCMJ TNHGNHOOCSTXYAFZNORNSBZJPXEHNCUPFIREEMXE PLZLRGWTWUKVUTSOPFHGJIHFIJLGETLIVUXSGSLN GPEMOVDSFBKUBSEXEVEFMPSNTEAKFSNOXCXGYQYA KIGCASKTUQBKUYUHAFGJPMINXWTZHMDPFZDWVGEM VLTOMQFFHZGRRBDZCXEEGHLXOEHYCFADQGEVBVYC SSHLZITZFRUNHBJXDYWWBGTBNDBPQKEBBHMFOBOU YRVBLLLBACKZXTUSXSEBETZOHDIPCCISZOESZJNU JSRGSIICDIBJRQFSZCASSDRZGVVIKBXWPRXFSTWU UJPMHTIVCAZDCHEKOXLGGNMYZIFXBJGMHAAJXJJV DRRHVAGPSDQJOSGARUJIFPFYAYXITMHIUVTQZHJE VZDHMWLHRHXQPRMKNPUJHQZIPEYXUKXAGUTWUGZZ HRYFACINDGEFVKZTTMHQBCONZMBWBOQBQTBCRDAX EZRMXQPEOTHSRKZLAGWNRGJXNYHXQUQOUSDPPEJG RXTRGIZANARIVAFPCDRJBIMRUIFMHIHRWNHEQUYN WKMSIFOAWJQVLBIJIPJPFIQMHRPVNBVZJHAPZUKS QJZJGRVROSKXGSVJRVRPIZTOFYMDLSMBSOWFDRUC CDNRZYXDXPWBNVROZNECYVAWLZRCAPLMIGHGANJX OEMDDLSXGUBXOLPQXKDXWSMKPCHYTCFMBWPKSLVM WZFTXZHXVFTKRSDXFBUVKWCMVIOBRIAEAOACTAPA OLOWVBLQOLYUTROFVDFECTLGERZRXYIUPFVCOWCZ ZKSBXZKNDPRKDCJXBRTDXRAOPACICFNDUOEEXLHV XHKTIMIISOZFAZVOQUPAPUZRISXBXKARFBYDELUB XSVDAGNWQFZZCVOCMVBIGGGBODILRZAKJWIRSHXI TWIKVVSQCRRWDCAQXSARYTMENYCWKPOOOALFZHWD EGVHVJLMPVKAZZDFYHKJFCTTINAMRKGHNATJLJXE WLOCUYDIPNMPKWSWFKZHZIYIXGQMPJPVQZYQPWBN INGWYWDRGDVYTQUKMLULOPIYYHTRZKPWMPNXAUEG WUJEZJBUAACPTIAWQMADNQXZSUGCTJFVEEMYSVYE VCSVKDDOPBYEMRRIKRLJLYLVOKTZMAEWVJONBLMD VGQIWOYDFGICDFGMDQWX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      AJRVFZIFYVCKCSBCSBUXDOQHFQCWUCTHWUALUCOC ZFSBZWMJIQAPECCXAWGLZOIUEGOMXDNUHAFDRUVN FKYJXVUXQITEENIDXFIMBFKAOIVINNXIAUVAERKW BNVPZODNMUIBEANKCZFMJLXSVAOCOOMQDQYMONUK FQHYPWFVZCDNDDJOLMXNHHMNHVULINJXLJJWGEXQ MMPQTZPUNIDDDEIEYGTTLJIAYIYZVSCUOLDVLHYQ KVUNPYRHEWGSJUOMSHPKDXMCQZJXNGJOBHRHFEWL ILXWCVMKPVKILERCIXIYMJXVDYIHFQCRJHQFNHPO SYPRRDPVLTZYBDCYZWLPMDGROCAWPNEAZKTQQFYN XQDZMMDEXBTDTCRONDIBYKNSWQDODKBDSMHMNAAI IKCMXRUTSACJPSBFABXEUDQNLESGACBYMQIWNHAV JIWGGXYLOIBATRQXVAOVWVBAKBXGPCQALZIDUCRV XXQGDEYUCXOYMXKPANGTLVFYZZDGTHQGHSJWTHYE AVQNXPMJPPWXHRFXBNQWFETWCARHDYAMVMMQHEVJ MJOSCWZKJJVVBOZZTYQZYRFQNSWTNDYQZGABHHDS XQKHDHOBOYJJMRUUJSFAQYXJKGIYQSNPSCEKHJCI TORRTIXJDZLMOCVSNVVFJPMOUJKLANCXHLHOGNZL KGFWZYMCNIORBWDMBPVLNMOWWPTZWEZKKCBEFGIK FNGAUZDYQGWVJAQROAMDKJCLABOXPDRLKLRINTUZ BIWFRTFAWEZASYVYTFDKYHFFIRUCHUYXDOKEPZIZ EHICCVYAESHWWBEUCCPSYZZCCGSCFDAUIEMICZHZ TQYPMUGOWAOJMSVZFCDUFDLESZRBWODNSETKODVC PPGFDTIHAZETZSJPOVXIAJDYGSOWVDDPWKDSBJSG ABGBMITLOAIEVSRASFBYBAQCCZMXQKUZEWHQHZPD BCEJAFKGKPOGINMEMOICWSUVAFCKCLUTIKKDROLI NMGSNPNIVDXJNTTLNDUDTXIDUFWLRKVXIDECQVAR GGRUAYQTPRNZLRWQEICLVIOCUTUJMADEKAZDOCEQ THTPUBEITLFQAHGFXKJIDOWLTGZXOSIPCYUNINWD XXPNHDORXFTFMTQXUGEOGAONVDTKFWJBSJDBAXSZ OJSNQMDUISJZZTPSPOAWZBBVVIJRJXJOUMLDFWAP AXVDFZWWCGOBOSDFJNAGKFGVPUJWARGRHJPSQYUK WODLYZRUZHEWFFGFAJRDMZPWGMRNPJWAXBXFFBJZ YUDGRVUZZMHUXXELGJBHMCRXYPLKIGMLITFASWIA VVOYHZLSUXVHQYCZJYAVKZHUGYGPAMZEAVXRAXFV ARIBRDXJMLCARYDBQUCIYIHVRINTFYCKQNMNZHQY SDJKDXVMWTBIHEPMFTECQTVVWPUDACHBPXGZXQVO JRSKKEOQASGMAGJQQKXMBVSGRFJHSXAYSNKLWQEQ GAYEYPYOGDOJAJGWRXPAKOQFBWYKULWOFUBIZCVT IHQRAVRGBVTHUODFPTITTAPIATYKSNWSDFZUWINE FHOJZYUKPFINXFMSCAXPBPEJPCKQIWCPMPYJNDHU HZERRASSUAHUTTFTPAEQAYZWJTEJODVNPIRLBQUV EMEJROPNOKGUHLKGWXOHIFBXABODNWCITSJTECPU QZGMIOUHSOLUGDZOGOGDWIPDOTJVXTTHSAWGXRRD QTCXVHMIYEWBYHBDIJTHWPNPRRAZGVPCJRLIZMSI OADYSPNPCAXKLXDNIZJUOMSOJTRSPDSWBLNXAMHI ETCPAKUBZVPWOILGWDPCOIWQGHRYRKFXDROEGVLI UDSFWSQFSKXOPUPNLPNXATRGKZXLPPCMTBPXOHMR DAVYUTWUXMCPMESUXZJZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KVVGHDKXGANAVOZNMFNMQNDAIDXOOVVYYFOXHBNK VSSZUGJULPMTLHIOBTRCZRXUZUYDAFUXBFUTMIHD BIXQSCFJFHQHRNKOGVPINDTNRKCTDGCNLOTDOYZZ YZJPCMGTDVEQSCLPXTMFKTXOONTWYMOSGOZVQJJO VEVCLLTQJZOZVEMXUEZONKDEOZAUPMCGIPLEDTWS AHLSGPHIRJNPLLCPADIVUBWQUDBBZGDWOIIMRXVD HZKKTPTAKVMFVQSAYKUYUJNVCCHFSNTBTMHMVUBR TQEYTWHDRJJRTBNBWKXKVCQCICPNNTCCINSFEOBA JRCYCLQFBVJRHEBYMDXTTHGJPWXQIXEHGBPLUZIY TDJQNYYNHABEOPPIEOVWXAYZPZLSIDIWEFFEXMRJ HCYFVLVPOXZXZQLXBANXBOJIEFNAFCJMBPZOOKSG QLEDNYCMNYOLNTNZHABTMOWARNASTYPXNAELIZXZ YTHGMTXDOSDTDDUMDAYYKJGLGRZAYOWEARJPGYLM CTCGUVGNGOYNXEHLEADQWVDKQXRTGBVLQGTMFZDG COTFSFYYBRPFNZOETQKFGWOWQDAGBQYHIFMJEMFW XWTMLOMJKKFLGAWPBQPNXFWPXEAOPKTRZRNXMXXZ EERGXEDBILRFXNRDZCUHAMMFZRULWVQVHFDFQMAB WBQIFRQXAJGWXBZPMNFCTPPDNRUNEUFYTJQRALDN XNFSKSEITPLMYCNVOVGNMLSZRADJBOPGSOUOCGVW CPKZYRYWDFPEYNGXGKEYWAIIHWKDNBPBDSHTBTGQ LHWUZOUAJQMBPNOPSHSPOPYZZGQDBMDMMJJWINNB YZVEFRXEONVBSJNTOGEKSRUGRBMRECRJJASMVTQU CUMMNQGWXABQZBWRNTCAHORYMXHZOGJIKZKYJXZH IIVLAMJWGXKHHLAPIIVJQOIYQNXORREYINXGMGFC VSAKWEAYBFLOWZWDXIDRXNZBVXZNTXZRZXMHCAOO PAKHWPNXPMKCMLKGUIKTHXLSCOKCWEDUJXYLGSWC NOXRDWVCCJVANLZRAAFIGVXCRMULYEJKJFVVTYEJ IGWOZZCUJTJUNACMBMMZNYQUARRMQQGSSNDODZWT RAIIUTWLYGNTMYZUDAXUZQMVVECIVRHWDDQILPEJ MRFXGEWNFNVICHKDCFDIISUXSSYAURCMRUKWPLVN TLCCHTCCUYLIEBVWCHJYPLACFFWJUVHQTZROYLYR AZKAMHBJEPJIXMKFDGIKSMMNSJKVPYDSAOSUQKRY YIXFSYUHEMKIMGIBKQUMIFVZPVCADUUOIWDTPBKO VUJVQNBVGFAFUQGYACQPIMITTDSVTZUMPSNFQNAQ RYDZGYMHPYALGDDXQTTVABSKIFLMESFBWLJGHHUZ IZBAWZHNIPXXSQVRNALICQFQQJDEMHTEQPEAATCJ UFLXMXQQWSINJWDCITLKAATKVKDKZGEWXDCPOGQV UWANZFCURNTPGNJWIBFOGWNJABYIQKXMWXNEFHFO NBPDMJEHNEIJNSNRVTZUOIOEOEIZKOIHXERVSXEG SXOORNPBUISKMOTPRRGTMFELLQGEGLXJCQJLOCZB CPGVFLBTEFFJKGBLFSIOQOVWRNEIGPKEABPQMFMH LLAJIYCRXQEVKVDNJWOYLRJECMBGZQJKUQWZASVW RTOVIMBBDVZICNXJWSLEFABIYISUVZVMTSXHOJLP DSKUKXGHEHJDXINUKITWULHUKLTNFBHSWFSHETII YMOJXTRXQBUTFNXMHJHSPINWLHGYBVXCCZTJFDNK RQKEISXIJEVAIQICVMMCKFCZOOIESOFONTWWIUJO WJPDBAZJIIHSBSRKZGEZAAFLAICADDCSGRAFRKHU VBRBCEYNAWDOVKTHSXEZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WHBOPBVRFEUHJIJLNAMRKSYZAJCAWLIIFLTQCHGN OSTSOVMFJQIQODYRLBMBALUWJLIZTOGRCSXWAWOZ IWLPPNITJWKGOARJHTEBPFAJWIFDUKSOAXMNJYEY FXWVHFRUUQHQHCVRUJXMHSRBOOSDQTZVUZLJVFUW MGKYFFJHDLBSYXNRZBKFZRHVMENWXUDMAQRXPOUT BWDSNZKAMLSOTGHLGHWVHYSCDHBDOIPFLLMDSABZ USXXYSNAODKJDNMQXXNIQSJKNQNGJEOCHROPZGMC XVOCFFAHNTNKVGEQISVPAGWUINVRLEITRUIRRTQR TCMYMTXCIKRWZGTQQZTQPLXYSBZXDILTJCBXKOHS CDROIHEWKSWHMARUZRUWIXLEOXEJPEMVNXQNKREB OSSHXWXYCEYPTOJXMYDYCZJLYMWNJHCXUJKKCSXG LPWMDEGIIXAETNMSCFTQTIWAJLPFOEZNCWXTDKJL MAZTSJTWHJCSIFUQCBZFPRRDRSBYNIZUPJFELFKA AFJFCKCYCDBLRVLJDZZPFZQLMYEYCSYRFNEKWVJN ZJDNSRAAHJMFGPOCLCJKOWKQVAVBAMCEINLTZGQY GGXLHAZJOLHFRGACOMMOALDVUFAEMVHVENNADZHJ VCDDNPFVZUSVUATAIDNFAEXLMNWXEQUHBWQUNOSE ZCANVZYETRLUXMUXNTZQRCPWIDEEWIRNNBBOHKYW FMIOFCLCLVWDMLHWFOWEGRMVCETMQDIHVQDVKWNR YCMAWSIJJHXHMRUKJSZPWIOCABVHJIAHTBDKMXDZ YELHQFYTRAKLOXGKTWQBVMDTUEBESCWJMCWFIULU CLXGZNQACWZCEFAOXMKADBRBIEMJHTANBQTDSXBF MSXOABRNDWTKNOXPQWAMATIVNAGVXJZWQFCPWEBK IDYPHKJBOBJFFGIAMAOSJYUIQLDFXIGKFPUZPUMK FGWJYBXERUNZFVSABMYEUXQROIKUDJJVIOAZWTWG IDDGBOLPVWPHSRFKMYQEEMEOHWXWNKWKJMEBVXBZ ONQEIGSOSPJIOXMMJIXQTDDZXIDJFJPSMNPDBLZX XSXVLLKPKOKPEKTVNRZEURIBLAQACKYVLZERFNBO BDSZXCORXOQHBRHOXRHMVJBCJIADDYRVTJERWKLS RIROQPYZSGHYHTZNZZFCIBHMIOSTZBZSZLVZVFTR HIJPKPNJNKFFDDFRTJZLZKUBFFESKYCUALVBBMHX ZGIZZJGTURNYMHNJPWPTSFVFHHDJWZISRPBSUPXD ZGCLPDRIOKTNVZMMCKOGDWZVDZDHHSCAPLMNIVPZ XXKZSGAYQUIIJXZIJKVDRXFAAWVEJYAOYOJDINDW RMKLOLPTEVRWLPCDESNIERQLXMYDYBJUXTRVHGCI NQLOWLDWVQUDWAYLHEQGPDFHKQJKRUNBWYNTIPRQ PZCJHSUDAVVCSZCMONFRFIMKWLNWFOBPQTHIVIQW SAMWWYEPZPZTJCABBKREKTVYLDWRVNADAZLGNGEU MFQVGPBEISYYAOMJNFDLDWPQJXEASPDXCLUVRRHB HUGVTIMYCLJLCZSZUMUKENJCYGTVBCXUPKLFFJOF AQYHJBDJYCKNDWQCTKOQAUVILJDTTATHBGCNFCNV IKHJEMAZLXUKWHMCVEZGKVXEHXRAZOCCKTTRVAQP WAXRKHEOXZAIVQNBHIJYUITPVTKQMSWRPYABHRSA UAAJLPPRVAEVFRILGUVOVJNUHFWOULCRNLFBQJWZ AXUDQFHEJZCZIZVEIXIFBZOTQGWWLDSEHTMRKQUN PASNURGIUFKEHNQVIPZGUPMDMKZETXSPGKJPKXCX IAOUOUYMKZVMGIWBKHDFZNRMDHAUTHNFGFLMKRXZ INAXZAMKEDFIVSXBXQQD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RRUYFWHDDANVEZOJNHPOPDGBCNRUHBTERWPVGLHZ NZUCVYDPMAYNJUZNBGTCQEQIAQZZNDYSYOSFOVYB GPEEXDHMLYPSBDCPALLPEPITKKHJCLNFBCARAESI QXJUBRJRGTHLYETJYXDEUDAYFYVGGNWPSXIKTSDY BZGPDMHTNLTYCIGYRPRFMHSBOYEWSFHMMSHOXPOB HVVCAQPJKPGSYMZXGTQMRZIZGDWCCFWFEGNLAPAJ ZNULTLACRKHOABEWHBYRMYDRULFYNCVRFOBZNLYZ XWGZUQUDAAYHFRNFRIUJWLTTZTVXBSHKCXPMKZVH YTVOVMXXPBYLQXRTFEXGIJGKHEEYAZIIOLMUVHKM FFAIRCNMECADDKZIQZNAGXCYLKLWPBLSBHCIAKPV DMMNAVMPXENRDHOSOMNNPVRDWSUCNEGPXOPFFZPX BDSZGQWYMOGJUKLRJHMZBMCQOCHUMAKJOVLZBMDU HWAUUJCZRNURBAGLISRAZSDZKQOSRZZMYMRKZIKR CLOSCAQHUTMSDVJFUPXBWDMEDABAZETDJNIKGQCV EQFSZUVERBQUNOPQBAFQTLJCAPRUCCISPFFAADQK KUMIOEEIUSDMGZELFWMNHTOLKTMSKAEHBXLKCXOI EICAVXKWVECPPZUOEWOSQSWUTJRPEMBISKCOPXJK PTNRLGJZCOONLCZMKGMBAVMUSLDMVHLEBBYZMUJK VMBINWMYAKKOKWFVRBLNZTCBJZPMWOKSODOVJKIP KSAFSWBRHODMPUNEUERDMNRBVZHWRQJZRBTBNBUS SJPUNPLJSNCEPMAMCGJWIHGFTCSYSYYNHGLKXNWK APLXNKJONVYKYXITENVNAZBVPOMNFDSXCIXZBSCL ZVXTAOUEBOEMEQBHCWHLEAQMBCMUQQZUIVASIMTI CXIUQLLFVUBDNDYISLUDYEZOPRHTQZTQCKQPZRTM UTIBMDXTAJJFQSLWDUMQBZGAKLAMRZTYOBJFVWFE JCTFXOQQZTWRXGFUTCRSBQRGCGKALJWBWNLFBPWQ CBQZUIKSFDGSGTQEJPSAEKTCOBRRHWNIVBRBXEQX ZWNXGCROCZNQJODMGKCSZWWJQTXPWAPOMISJZQRP CNPNMAFTNGKYKZMSZYUOXZSDKNUPWGTVJDSHRYAC XTIUTJUUEQAZCYPSAVXRSJDCOIUDXUVWPWFHEOYT LWWOJTJRBAVFBJIVSIVORGWQRMLPRPKWAUATJWNP BDHXXJZTDGZAUEQVOXWYSWIYOPGPJIPCYTVPNAHI RYCAPPKLKWVHJEDQOQJDXXYXFGHWQKWDTXXRVKVS RLXDELTMFAYJIUVFJDAWIOKSFTTHOIYKPWNGHIXN ONTBTVNAHXZADCATBFOSWCUFVBEWTFIZBCBEGZRN DPMWXXBGWWZCTFDDNSOLLACVUINCMXIYPUTRARSJ OAWQHNSYTRBDYZTPGHGAZBPFPQMQUJJQWAKNZXEQ JLTJPLDULFKOZWQFBDQGXKZQKBJMESEUQXOAYACP OMBQTYZFTAAPDVVFBNNIZHWFROBJLFMICDSNQJCE AKTHGBVBICQIIFNOXNBHVDLDEDSNXXRTISZOTODI JKYDTVGSTZNSFPYFKGDSNYKYZBWTZSNMPVPVLWOF MIHAPADBDJVETICFSSMZLGKESUVGGHLHJTZJVPHY ULHIBMJBAIMTTVQOLBMEQWVDVTQMWWAUQGFNQHZK KCWVCWEUAFFUAGQNFZUWIXOKFVYFXDAZPDYAOUAC PNPCEULXLNGJDTDEHGGFIIFUQMOGEMJEOPUGWBCP KXJUYLXAZBMHYNTHMLSXNVVBGCOCAKPYHIHMKPJK LCHIWMYZBSUOJIFWBKSTZJJCZDZABBOHZLTWKFZH TBUDXZKUMGFQZBOLLHTD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      XWTZVOCKOQOFXUENHWOUYBGPZDGZOHGTQLXADGBI QBJOHOOGNMIFLRLTOIWSSXSCZZVXNFXBDLFXMODW RYWJBJXGAVNNLMDKNYJQMPDKHOLXDOJJVBAOTJJQ CDJUWGJPIVMIJPAZHFOSLOQCOCHVVQDXQFLUYFTU GYAMDPKMYKNLEFJIDDHKJSNONSWTPXTJCARQICLY TBYODQNFTUZLAIPTEQHTJSFMYGMSQVPEJBGGJAKF EOPEGLWLIBWBMXSIWBXWCAEJAVWMXCTILVHYUSGB RAKXZJLILHEPXOIRZCHNGMDBOXWYAZTDVDXPKZSQ JYPTGXJIRNGXYNSGKDKGIQUKZEIGLJSUQBMAUAAA FSOERLUBFDDILSYBYJKYPIJRQEKXDJATNQPUMNRR XSFGDYTVYLUDXSUXZYRTBEJTDKEBMEACGJQLTIMQ AKRBKXCIZLEXKLCMNUUBJMZUEGDPYQOMLKLVQXVJ XFYUUFRRVNAUEGCSLNZKKGENGLMSHFZJKQGPTVLS PUVPHOHZNPKKMOTWFJUDTOOUYFELZOFOFLETSBGO QSXSHYSJBRGSELUJXRSHPLWNOMMWTSJUACWVVYYP OFIFYEFTIONAMQBWEDJQOIWWVSEANXBUSOUELLNN TVFIFUFXDOWAGASABKYWMJYWFDNLRXPEBUGWUTKR XBHNDHQVKJPFCQMUTQPSAPPMLSRABVSLFAVWVWQV RZEBZSRTSVPLSJIDNQGXVDZKOSNFCBDDFNSVIPPO XQHCHMHJPPAZGIRPPVPAPXPEEBMLFYUNPPAGNMGC FEOBHBECRWGWSUHQIAHWOBDDNYUJTPLZKRQAHJWX ZVHNEIUBNHCYKWBLFJKHTECFICTWUDFVGYACZWFJ KFDJIYCUIAYDNUURBAMVVIDMEXLELZPNMEEDHPLH ATNMJTJVMWANVEUOETUDZMTALMUQZDJMKTFQFYRW VZUTFVYWEVZXHRQHZXIHVQVPOEQXEZQMKGNFYWYZ SKNLEXWWKMJRLYHYUEGJNHRMVCOZLSYAFRECTGXS LUWACFGHPMFIKPFWJMDPZNNQWTUHRJURVPDSWWJW RACKFCAXLYHYGIVMFMFROVSZZSBJHKMBTTZNVPCL VITLSQTKLQMVJCROSYQYVTRMLTNXCKSVXTVUROHZ DSLBHYVHEIPHJMSHVZDCWGPPRNYKLDYHPEXSFUQV KYGTWYVSZTAKZZOVUCWVXNPVYJVRVXVNINIWORKS MACXGQPQWIRVLQXJTFMNJAHUOJMLSMRTCDMVHHRC BQPNDXOYXJXZFHREVOIYQQCYOYTZMPOGUWMKMCSD HCNIGYDCEWRYJTEFMHUUGSJQNAIKYICLNKFDSLDA TPZFVNJMAKLGQPTNMEUHZYFVYPISDPQAGHCXBKCN ILFGVDQEBZSNNIOUAMBFBBTKCLHZSWIJLDWYCPUJ UOPFARAUZZMWDTZJUOWNMXMBALMVVMYOKSGUETGF MPUDWIXLISAMRSLZROSPYLMEQXLFWADSJZKGQECW VVLKEXKFQFBCTADZNOIDMSRPPZSNRAEJVZVJWOCJ LFTYVFRCTFYISWEXGERROFAALHOCEXDONWINNTRJ KQYKQKTFSFMTSAGPSFZDYCMMOFEGFSYUDYONINPG SYWWFWHHWDZHXVLADCZMYBAXOYYFLYYBOFJUIEQV VGCAJEQEEZCEWRUGCETVKXWTFYGBCANFBVKAEFNN OEXRNYULKVDBQCLELSSFVFRIPSCZJALUTRSKPXBH KWVWEAZYAZKQMCYRBHDJMGLLRYIKPESAAZAWVAAL VDNHVQFMMYYBMMAVXBLOLGZTKSQHPSWJXIFKXGIS MGTQIDIEFSXFHSNIKLUPXJCFAOUYJQYDWXNTRYTM TEXSANOLQBVJMCXLIRBU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HWXAMEZZOJYKDIKWICNXWUMNMSAWAXZLMQVAFACA JVYRBCGIZQEEVDWHRMIAMUCAEIYCMXYXTEBUSPHG ROPBTBVWLZKRVONMLOFXNLKDHCYSVFKONUNYXLGL IJHCYXQDOPVREFSUMWFCVFUNIUDVZQLRLYJCJNZG PAUJKLXOHBYKXCOIXDFWLLKEJFYBGXIOBASJKVSO PJTXDEQQPEDODFREYBWVLLIDHKYJCAQEMRKUHGMA YBQODASVFEEBRCNHGWJUBOVLHFBKCHMTEKEBARNL SSBFCCBATPQBNQBFLDIVKQKVUHHJXFPMNFLVPKWU AJDJWZDVIMIHNJIBQHEPLLSHGJTOJFRSCSUNLZNU VTUGYVZSJTLCYNOSDXAELHGKRKFDZTOQPRSOCPQW QDAOGZBAHQDJQWNZGXCEKRNOGQPJMMIEETWHFAAB HKUARZRWCKNQLSUBIYTVWPUSJRQGSFOTKYOGMORR XSNLSNPDZKVXEYKHNOIOEJIKSYCGQZIYDNGOANGG LQKXNWIZQBWMEQVFJALHARWBTTPPAEZWMPMKFPKS AFLTAQQMRQSTEHLLLESHYQAWDXLKLWUEYWIGTRVF CAEDPFYVGCIKRRUBHULWENZPKJWZVJOEZGERTXKL SQWIURQLGKGLRUVTXMCMIAIRZPGEIBZERTFDOMMQ JLPDQTMPQZJBBHRWYSCXXMOILQCZYEKDOYFTZTLI SRHLVNBXQYWQWUWLXWWWAOLPFDPVXHDEVMAFLQGT FLLOFARBGECALHCSGRNESTTMODIQEOAQNOPXLUFU YSBOABNKWEXKFHAHSIHVYQJAPMXGCCHGXQGRAJTX STVNTFNRKMZQANIUODSXWOVNNLGMMFXLSYRQFOSU NTWBHDARJPMUFBZEJMQZTNIGUSENIZRQKIZEOACQ TIMKDDFFPDQEATVRROWTEVJPQNGVKDOTBPHKCGVC SSNOFZEWWGZMCLUUPGBWZXSWWSZRVJFBAUATFLBW HWLOLCTCICOWHDIEPSEZGEXBBTQNOBTOWBGQUSOD LHHEBDRYLFGNHBWUWCALJMNJGJFCHENNZGBUVDAS EYERAOBOGOCIAYHEUPGLATCHNHYTCFSTMGJVQLQY ICFAATKXSALZWSRTWKXCPXNPSCZNIPEKCKDVFGSP DIHRITILDBBCZNPLJGBUNMGAWSJWEUFOSLQKOVYG QSHNEWFIYJCYAJUUSOUNUVDLBMYHKCSAHOXITMYH RLTBVMHQMWPOIMDYDEADAOWHXUOVSVQNEPHSLWKV FFYJYQMKLJJHIYIMSSOZBEYYIDSAMGQRMNWGYHGT MTSMAHCPSJQCQNTRMISDPJVYIPYRPTUQUAVVQLFN UZPGDACYRQFQSVQPFEISAJDUMVOJARZXIINFEFNV QRFYFASZOCKHCWECLZBMNKEIKOSTSJNKCZWGERXQ HYVLMJTDDSSDYMHOLRJNQEFAWSXWZZYAXQECVBXJ BOJZCUPXWESEPIQJNPYWLGHKCKVTMXYLMFPAZJAU ASVHFOBBSNIPUQQXDJIHQXZDUCNFDRBLWPQAQBBS YEKNSSQDMMLHZFHUKGLOOBTPAVKERJDPITMGKUAD FJELUZUQYMXUIYYGJQISOYWTFBKEYGRFNHQXKKYF PHHLWSZPBZBDXMSRSBLPOFPOEWVPUGFTCSAVQRFV EYBORKDWXXVVGSHPSUDEUJVHTHUNHOFEMZLCPXGJ MEDWCVOSSNEPNHNDSWCDGMZOFKMUTNZUZLXJJGCH ELLMERHZJQOSOHQUQVKLLAWFEHSJNGMAVBFYIQZP DOJQZGQJXLHMBMZAZWYNDVSKVGJPIZNBRSVTPVOP CKOGBEEBCZLKPKZKRGHDHWAXWNNOFDPEFCQCSFGQ AUJBNTLSWGUVXCMESJPE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LACAQRVEMVBFQMUGVYATMAGECKBCDWDLYXJGMXWF JOXUBWFDGPGWSAOHEKBQIGHFAEKXOADILKLSRSIS ACRPSOYMSSCOQRJHLHVAXAALYLOJGILSYUEYNPVE YASSCAAAPVPJYTLFHYDIZRMJLQMBMFDNCTYUQIYF NGZWGBIRYNCXSMPYHDXMAFKVTZPRNJKDDVCRYHUO XIKKVKNHREFFRMOKNEIALNAMOQHYRCDCJCKBXEMV TXMWBNZPZYOTNFABRQFCQJZFYSUDHIYCNHERVXLB CLLATIIZFJRGKGFQPHZZCUIQODMLLAUKDYWAQCMS PPLKJRAQAOMGWJSDDXULLWWBRKMFAOBZVAUXUTKO SMPQAGNVMCHYGWVOHQQBTJKODNPAZUGIDFYSPEDB ELLFDTPWFHJYBYKRUHXJOVJDQVZMNAOSICMSNISF PSAFXYGFUANNYOKSQOQOSBWPPPZWAHIJDOIUBXKZ XDVCHGHTENPUPATBGIANCRHEVCNCFEVFPQAMMGDU TIGCASSZFYJGDKJQYWISXLCHUVSJGSZSZATMYKTZ XTTDOMEAWRNCKWEJIDRHCKFOVMKRXYFOJXEEQDUT LBMBCKXKPWBWPXMULADJHLNPHVLQDPXRUPJVXFLN RGXASIOHMUAYAXZFJDKFTDHPKMLULHBFZCYFMDYE YZXFTBPQFGBHDFTIWDTMVEVSLFJFNBNHTZLIJTGB FQKCRRCIVAKYLXQTIFDOLZFAQUUIJCRUUDBGFHFM YLDAFPTQARREYZTEYRVNQBDBDTMKCEYRMRSQDFBA IKPOZVNPAWTUDWMRZJEBLKIZIXZOZFRAODPXWKVW PJSCWVPEFZDOQUJNBXVVBTWYMMBJYXBSETULPCOO BEWNRSARRWUVLNHSQQCNPVVXFETREGDGCSXQQQXJ EUZLHJAFFJXSPDZXWTDFZLYRGTKGNZJZXSSSKJFR IBDZLHLIVGLZNSZCVOFJKUELYIPBIQDDZQSESLQB OILUNDVNXRXORDXIGSGVTBVUVVOETSIXJEMVBYAO OJPHFTYIZONVXDAWWDASTQUYMQFZRJMSTFDWOTAL ZSJNQKWGBVBJNWXHGLWXRJADJASRKXJRFJBEMKNH MJEVMEXFUQLVPPAOLOPKYKXBPOKRWYUROVWVURLQ JMIBUMKNUWBTNHIBZQMUSICFFBAGTOHHABRCHOHP XTHOCAALVKUWUYMDZJQVPBWIFYTMFHVHJPYZMSQV SXIMOVJXQTVRYYMEWEUKRAWFXGBGZGVMCBDSQIUK QQDLZRLOSVUAWCMZEHNTPCGOTFBAFNIQJYNLJRCT WDYTBBUFBXCIOYNQHXKRTTIMMAKHZTNXVCTSRTRU WVOTLRYZUMQNUUPCFWQXNIRIFQDILRTHBKWKPAKC NNCKJYYASZPCYORKNYYPFNROMTDMETFLBUDLHPFR MDQEVBBTHYYLQSNCANJDWYBFCKUVJCVYXRJOOWGC HWHKLKDKJJCQZYCVTLZRBHRPUWWJZFRSMALFANOF IPQAUEYUFITAXKSXMDROCVXLHKNGRJPYHODDQZFP GGJOXTXWLCJJNDSHLLVBAQYMXXQMKPFBXAGUBZHO PANZXFTRIKQNZLGUUQTFGFGVCIMYQHQDRXWJVZFB ZRQPOHYDSQRGZZXPKTZWOEZIQVTQLMLVJLNXFGFU LPNQCSBPLJBHIBTRNMVNRPVEYQDWZJNUCIKYFSAZ XHQAEMEOICVSOTXVTURZEXZMPJSGORAYFEGHOFYC CDYAVKLSPLOYKPNIWKWPNGZABETJLNAIKRUBPJQW YYURAZBJJISUHNQWQRRBSCFXPPILKZOLXPOTKKTG YUTIJDXSNJQBPHYORKVLOFNGXKYWOXMRGPBPFFER LFLIHYGGWIFKRWZZMSHP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TDEGKXFOCHRHRYWGLMBVNMYBOIHTUZMIWMIVIYQO DSRZUNUOIHEKNHNBYIPAEXTEAXHGFKGPGHTHJDCC YAQNUKMPQABNNOIWNYKCZUWGNPLBIROOOPQSLMHD NOSVWCHGITEWEBXWZWDNUSUPYTBTDBZASPQOROWC OHHGUPWOQZDDHODNPWEDZYTTMORDMQDJRTZWHJKE NQNLEPGIRBVYVLWNVFLOXCLKZDZJKPDDPZJNYCTK HINHDMYRZGEGRQOJPOJQZQMEOUWGEFNUWRDEHXVM POMAIGYECKSYHTQRHXPTMSCALQJSKAOYJDWAVAEP PSETBNDBCUYCZDVSXQXSLOUAHQUNMPBTZERKIZQZ WCDCKVIZBTRBATMUHIHKSVNVNTVPLZRXWWTTEZQQ BJOYEMSGAVOLOYIIAHGMIXAYOZPGDVAIOUKUPLOD NVWTIZCYJUUMDXQFWROYYOCJYKCPVFBETCQPGYID QYDCTUKTBLQPIDDLIOSOWEZIFMJAWMXSKEOVMUWX WCYRQIISEMNMCZMGMFYNIMUIOIRAZNAKNSOZZLUE SHYSRNVVAYBECZHTPIBLWSHCRHZWTCRQDGUIVQML SOIHJOZZMMTSRGOHDZEYHCQOIAWCLBWIWZLQPMFP RQAQIDPXOZYZVRFIZWROFDDTQBEAEYOXGZDNPUSE OGKSBFILVYRANTMCXOVFRUHHRAURMXBSYWLYEQFS WEKZVVRVJLKLAPFUWLIETIYFBKBSJHNBLHTFRDBX IXUVGCUNZMYYMOOBTIIILJTTRHJOCUBBOLAZLCCB QCFBTJBZVMKQTITMBDQFJELCMLVBFILHGWCOPATP QHANEGQGWSNKYZBGMPFTGSFVCCQHQQSDBNHLJGQQ ENNRCYGYGCQLVNKEIJLKGLOAGJCWUZNDVBKCVVDK DLJLSYLSIMOFRKVVVNXIXTKJSRXIGKAJLETGASUA QQOALSSTVBMCMAKTTJBTZDDMMXISAZXSHJGZOWVU GAWJUGVVZDWALACXQUMEJFASJSVZITQFEOGXPDIG LQWYSDCENDQXZHIFQSOQAUJHASVMPUVYCEPDFWKA NAOAYKKMMELUDCNRXWOHVYXLCIJWGUJNFZAPSCTP SXFOORXEZEMKADXWZIDXTPWYDICOYZNVKCXAVBWH MWLIYDDAGFJSRDNVAGKGPNLVYUIHFZTNVPNHCUPT WVDTLFKDMSDZXRHPIMAWAUTKEJAJTHGMUIGMYEQS EZTTWEQVJSFWKZHALSAARNESJKCQGXBPDAJUEQWW RAAEXYTSEMVWAMIJLBUSVLGAIQXCRIHBENPGSASI OXIBRMLSSVBQHNRCEBFBLAPLMZGMKVZSWEFRYAAJ MKQRDOHZEEISRKQTXJIMHOSJYBNZULUYFDTJCUDL GJTTCDEXQGRROOLKXGRCXVTLZMMVBXYPZWNBYRBL PRXZNZBZOFDTWBXARPSESHKKKTXFJQKFCROHXDZG OWVADKTXPENCPDMJVWTYHBVRGMRSJOWCVMPXSUOG YRAVCQPOIUECDXZKGFASMLEWQIPEGZXUDPORUQUR IJBLYECTRWPHIPWSBGDGVWHRBGMGKRUQBRZQRLZH TDVXLRVWEDLUKOGJOFPSMDOKHWXRFNFXFRBXSXJF SIJJKVBDRSIQCSTDUSFXWTBTLXCXHUVEIMKXYDZM MRIICVOQEAFUQDADRJYCPJZJVOLQOAFEKFDQVOTO RSFIJUNYZJHUEPVSNVTWVGCVNCRWPXOTRMWAHUYA BFVNELKBWQYZMLYMSMXEMXCHZBNLNLQOTWCGUFWO GQODLBOVORESVJJWPQIJDKTZGZNVRDLQDBITTPIG VEZMDKTSZVMRINBBLYDQSPIACZAKFXKYAYUENDPF PCPQUSBTQXKQJMRZLYBF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RCQQKTSNVLSGAAWFCBVUZKKARHNNYOEZRXQWTVQG MTICHCYYEOTLZLWEPJLLWUXMWUZUNDSBDEXJEBTV WIBHENTUCWCAURFWNPBBHOIGSRRJHGGPFPRLGAVW ZTTEMMZNRDXRURIACIXMTIJHWOFZJLEZMMRVBHUK FDVXXSCCPWMVHWOBBHGDUPQNVVSGHPNBNIRVXJUK SAZGAGXBHEPXHITKBPSGPXYEQCPCPURBQPYSXSZY YAQDMAGOINPIUJHXTXJPCCCUWFIHROBAWBHIDFAX BJXFAIULUWGWABRMUFMUZKBCPQNCHITPYJPNDDUE LGDLHCNYBVSLALXTZFKGGSCIWFTINEGWLMCORHNO AZHTRFKEWJOARLLEOZRIOAGPBYDOLHJFZRRBELWZ WIADXQUZASRHWGSBTZEKIIWPVCTHIPGTJUOCWFVQ NKEIJDIETUVCJUIWPGGNKICJGKBRHRWQQZCFPYLF IIKVCRNRBLMVMYEUORMTHWNPGLHFATFGPJDDKUFI YKFQGVKGTNSRMNNEOIEXMPMDXWZIYWIYLLOMRFOR ZDXNRDACRGGDKUNOEAVOSBKAFXXKIXDMDTYDSHQN XKFVYNYLIEIDUVNLEJFTWCVWGZPCTIFNGZRRCWLB PFDPMECFAZULITYEXUSSWFRIGHSOCQWGRSJDTIYR WBARDGZZVIDGHSORNFHZRDRJTTYWRFGAWOCATYEG FSHKNKPNRLMDWMTKXYTQHSFFTXCYRUVIDLKNXUSZ GKNYSKMJELJECWIEOXVAQUVVGHNCLAUULNXAQRKC GICFBQPFNXCISBXLCAUNROWABIVWCJMWEXCRPZYE YEDPOFADMPGZRNVKVIMYFHKSBHVIPZPTMWFKTEHI KHCMNXOKWNRODMUIHTTEMAODWBLETDQTKMEFWATL CWHNUQBGNKUZQBCVWHLXFHQDYBNVGHRKBJWWDGSC TKWTDTMSQILANROVYHHJEVFJSCFRICCEKOTXOKOZ WOEAOVRRCEHCKCYGOBYGSCETELOTNSNEWLLIEEPS FUCJSJNDAXAGYQULYBPGECTUJPLEVJPQJGLUTCBP UYZKDJGGUCIFCDDFMHLPZINQNOANSDGAHCIYESSG CDPCHYHVTXOWUHJMRXYRZTSBITPSBPSZDSLHNZQZ NFSDDFRCWXQFIKJOFLNPYGFERAPETHPHIVGNKNMO BWISQGXOATKFZNQDOILLIAPHTETPUKOZZAWWVLWR CGMVDVMDERXCANINCPPKKEISAHFLEYFVTDYTJKBF FKSNZFCVNVTKSPBCIIQJZHZIPRATKKMKZVOQHVBP OKVTITVJWMSAAFYEURWGGCXYOQXQXTMCONAGPMVK JFYNDMYPGOGWZVOQLLGKGUKFYNSPNUOUOSIBKFCT RSHJSIINGCXAPESXLLZVFHQHDOWMOHUPRXPBQQEB EZBQBSLSWBDLDEQGWTCYUPWAIJHCJZEFRNGWAOMV GBEIYSXZMCWAPEUJMJFIVQBGUTNJRDXDNOIMCYIB TMQCPTAGLCFRGGHOYFRSYUONQVWFTWVNDGJMSAZU SJAVLIWHASMZSYLJGDDMCSTYBWPEVSWGWZBRHYBE KAIQJQBMIWFVEWNEEVBJEOWJGZDMFGYHSHYELPDO RNGTHVSRWXXKBAKLKKFTQLDVOEKJLHIVPVULOCLI MCUMJYIGMLYSYMXPULKUGDDEOEZLLESHJLXOTZRG PHPXGESELTLSGMKLDAXLZTWASKLMUIVUJVSDLZGW XFEVMDAOKORYNMVZCXQZPJFFKUAIKIPMRCOEQICJ HDABZXVJIKQPIPBZJWFVWJEXNCUWDXKXGFANCEKI QVXUFSFZTYVBVRFSNIAVUSWUPOTRGPLYFDUOOMBB ESNARTXELRQVFRRQFUEV
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DKUCXOWJJYAGSSQRLFNTKEICAXZUYLOHPQIFEECD OPAWKCXKMRIRIJRIFWJHLLUPJIMQXSKFHPAWWJEV ORWLMRMDSDXFZNYBBNBXOIXCGVMCTUOHYCGPKQJA PJGKFZWJUVLXWTNLGCPZEVIUTKCPDZSVCTPYUMEE HXIROWAVJSZQPPWGINSXOEOZBSXOSETUDPHTKMQB HZIPDNBUVYWETCMKLWLGMKIRQZBNRMDJJAJNCGAX QOHHBOWXLLWYZDWLVAAQCLRWXGEWYMBAFJKLODOZ TZNCNJCBEXDSFUCCYZDONFAEWHQIQRKYQTILNQPW WNUTLHGFAJYDDBAAUHWBVUGTCYZBNZQVTTPODCQA EYDTOZYAIXYBEVERHJXQEQZIKLINCPDGOYIHREGI ETFRUIRSBRDONDFENAVJJGTSNYBBKXPSPOCUFMYX NEOAXAGUITZGKWISUKMRQDXKRCEPBYCIRUJEWGBU SRMEOKBYDUAQXYFXVVXSLNLYWDLWZDOHTBCXQETL MPAUJFBNVVGHPZFBVAZJQNTXPSWQTVOEMUVEPETF KRVJWJJQUIBWWNDZROUZDQPGERFJAJLIDXBTDSNB SFHINXCLKCZWOPSQYLUFSKQRWACWHMKMFHLDXABR CQWTMCLARKYVCFUMDARLCXWHYSFNBVKLWCXEYNEM SUOOCXMXASQCRBIFNRHUZYKROFIMCLTLDKYYHYLF DFLSSCDHCQCZCTIVNOBEYGCFYENBDGBKFUZONTWD TDSVPGMSJLBHDTGIXATIEKTBDZATDAIXNUDGPJER DRJJBBRHVKFFWTSQNQISGRPJFRMBEKCBRRYGJADG YSCJRKUMZFUVPFUAPQYVDWOFSXDWHDBVYONONCWC HPLACLVVOKPSJLOKRDDCBSXYZWWKODDKFACNFKBK GMCKQTQSFBAISWSLYBSGPVZOGHXMPNCGPYLXUOLD RQBDGCZHRYNWLENZXPMZPFSVXQOFSDLTIWFUAZJS UPFUUUFEMYWVUWPBJLDVSGCWVSXHSNPQIYAIZUWX PVOENFCXDGNSQRHTWQGLIOWOJIEMPJHHCRZYRKAA QTNBUGAECYYCOOYRXNDURJDRIQPUOKDMGGIUCPGT DDNZPVGOFWHRNELODSRGHXUBNZONXHUDCMVZAFHO RJCSWRYHWCKZODATREWDSOXZJDVOOHLKIMIXXTYN NKQNHRUADBUSMEJMBEZLXQECFHGJCCVCKWZOHZOZ FRXTXASOSQRQDGVFPCLAJPBHEXMAGKOMITOMOFIC EKQKYHDBREOVYSMJPKXAFJLWNOOWQOKHINLYDRYF ABRZFKFNVJJDPQZOPQUSUMVFOGWGCZIBVXYVZUYJ PAIDXWEXPGYKIIQFCSRZLQNFUVBLDZRKRNPMHKVG NKDOXUJRHHASKRGXAXJCSLFVHEBIXDXOJMXOQKGG WOFMJVYAUGKLUWUKRBENTGIEPRBIMBZBONPZTSAH QOOONYQVSPAIABXKOWYUETQCGUGUCJVZKTGPWZVK VWSXPBZXWEMEPPXLXAGZXHJVHSBEIFSJOVGWULAG SDQKSSSKWDYWXCEIVJJEPULPEIADRBXOLFKCTCNY YUSHZMACNEWCAKHNKGGTCKUAZFFCCBHNFEZOPLEF MVSZNAPWRZEPDTMSVBKPUKPEVVJNOCOGXMERYNZF NEIJUTIBGBVBZNLUCLFJCLMGFGWTPZCTKVPXUULX RVXXLBEGQRXTWWWJLNSXKIEEJOCTUQFQMNJQTPVS TSNVAFRYGNRLYKLRULHPOJMHJDLCXRZFUCKQEMQB FYAFGLHFBPADLONWLZILCJFAXZGATLMUSHDNWYOB LEKYDTLRBWDFQLWWPYMIKDYULBZKORSUWAVXLPFJ NSWIOJXSBNFDMHULCZSD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JBSCXSDBYVVKQWLSHORCDAWEEIUZWGLCTWRBUQBI RTCJOBXFDUPVELNNGIKVRQYJUQUUZDARKVLFEWEW BVNJMQPWWIZDASXBSQQGZOZSZJHWPSFGABLEPJBJ EVGQKZKDCFXETDOROPNOPFLBBJQRENYUGGBMVROC OAYIEORHTJLKSYPGKLYEBHUKUDEHYWQBHEAZLBNA TQYRDRFVRAOWIPSFTSWWPZFYGGKLUATRVLLVCYWC BHVXTSLSWPHFSXIVHENAZATIRIKQYFKMZIENAGYU WYULRMLORRPMOTRYHUEELOZASBLVAGPMSIWLIRVU ECBFXLLJFEREWQTYCBFNDPMGVILSJDNDMYVKASLJ UUNKUUVHCKUAIDKWSRIJKOIBGCVFBHXSXVANXDIM CJEODEOZYIHVJBOOIGTELXGDDMUGHYELNCGBRDYR XTOYNPHEGGEFOTRDOVDVITTLGWTKKIJGNJSTBWCX QXPFJGUOPOAYSBSSSOJFTNJVWXDVCHWAPERNORGH HPEHRARDSHAIGPRCWGNFSBCPWFBWVBGEHYFQHFSS RHIZQQSNOKNLAIRXNLANRCOTSZSIFKPIVNJXGVPE CAZHKWZGZQZDUWXXIRNEBCLOOFNUDJDNZAUFHYWT EMUXUXXBVEYEBTJEGMYMGTKYUZHNZGWZDWCUGTIA UMKEZDGOZCPWKNULNXUXIZJHUPOXGJUWPNUDBZNM LSALRORZFIQFJEAMLRDCABLYFIDUMIDJVLCMUJEA PYYXOTBPDUQLXXWOEOWHOUYSVDWDTVUHCLQCGLNO HMPQXEDMWJRAOKIRZYNKARKPBHYFSARUVQTXMKHM PMXKNYBQQWKSACRUGPOZVJBAEDACDRUDGQCOLBIX TWHHAEXQBHKKGVWIEEHFKVLDPQDGIJGRCPAJBOST WANOBCIVGJTSYLCNREFSDWZNGLGMZQZAQTWFJPKW XBNFBDQQGLLTRKPDEYDHPTGYOQEUSKIJYOKCJSDW VUDMCODPGUPZKUNXJHBLNGZUNRUNMMIGNLKTNANN IKVKNPFIZKWXDKVOTBGNLZXCLAMKOOVPONVOJJZF YTEMTESNCTHSGTGGGPHATSDBBYXLGNTNQXZTRLQO MFUEBXENBQFXCONBBYERNXPNTSIBRLOGLCCKBKIY HIMVXQVXNKFJRSZIYYIPRCEBQPOAYMQLMSHPNXJQ ZOGWMFKUEKTUEFNHRXSDHVNVSGLYGWCINXTDDCGY HTWJJGBEESTSVHCVPADRSVXMPNMWKJLZZIWPTOFE QUZKUKIOJHPCEBCBWCPFFTMGAHWXDEOQZMMZKSAY TYGJPJYBDTSHYTNVSQUEXFAZVHXQHXWZDWHTJPWW HFDIVWZMXUKMWMJOXHFGVTZJELCJLLESLAPNNSAX BMPVLLXUURNAPFAZILMZZXQVARLMHHITRBZAVQTY XVVEBWPCSDLAECHMUYTQNQHOEJHAIJPJKLBLPFYE HNKDHFTDZIOICZCWAQEIGQMNAPIWCLLBDFPTBMWO UUHEGSIIHWMKPVDXYJLAIYSPBUMITSZRZVYLDLWH KBWGUOIZXCMNXYYBXEVONLMOZVCMIEHJAECUVAGH CVZSDIMBHCSARZAGYATFXLGXKZQHOTAVBTDHTDRK PTSMYFORCFUAZLFUCQLOEDQXPGBZNNZSXFGISTWB AZHVRXMMZUQENIUGGDJJDHTYKZUELIQMJLYMSEIZ PVTQQYUFTENPBOCMQSSEMWYRQTOCULAMRVEGZVFD ZVMKZTPJKCVETWGCJCNJBSBWAMLUBXIDNKABPIDW SORBFGJYCJJHNKBQCBVQDDRXOFPHLRBXEGYONPGZ VMSOHEDTCZMOJBLNAMRHXCWXKRYBRZHXDKACYICA LZUQCCPEYYASZKGZZFAI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      VCWQQACPIFQWWFJEHVUHIKDBSEBCZFFQOAVTBEAQ UANYANGOFDYAQALTAOQZWTISLQBTWKPEOBIXMELA DZFVKREGHARVIOTOVTVKIZKHJPFISPGZGUFXGTVG WCFWEOZBPVOOAACLFZXGVQNKUWENJFHKWFUSWNNR ZFUUGVVLGPMNYDPKJECCCWJSUAGBIVBSSMLGPBXH PZVVZFZGMILENKEFQYNWROJZZWURUWIMRQHVLUOK FOUAIXNHIHCZBXYUKJDTTHQTGKICAEGIOADSIWTV ZLBTRCCWCORMCVOPTQGBAIZKVITJLJRIDOQJMHYY OSFAXJZNBWOZYBSUKCUWVRIHCZOBXMKKHXTKJXCD ICGGAAWUOVDOBIQAPGWDGGJGWYAJUWTBSOTKHLKZ KEYBJCWXQPCMETKBLTDKVURFBWEYDECGUYDALJKW PWSUOSIYATLOWEOYWSIXWUJGAHOSDORQQCTVQZAZ XAOAMCWWGZMNVQJBPGNEBFTJXHUQIYIIIRKTKZZN GTECOAKXRXIOUYRQVIKSCCKJDZLIXUWRDXIDKEBU GUBMQIQAMGEKEUHNMEFQYEHGSPDXXXUWUYHWMNWC FGQFBXCNGMDBMSDPLNQTMLYUMDZVGIKBFBYLMTYH WSWDTAAHXBFDTZFWHTSYBXLVUJOJGDMIKKSATJBP LAOEYIGJBZBEPQKRMORHNOGGWGUFNEABTBZFJJEU PMXXTLSTTSMMRQJUMTPFSHIQSKNMCUCBDWNGVMNZ OESSBPGSVNMUEJMPXORBEOWWGOLYMYUZQWENIIKS KZSZJEMMYEQITUPYTXUKRSNFWTWHNBWIXSMVMCBE KMTQQUINTZKTNUZYDTHNWAWDUMDTOLXSPGGNKMRW QVQAIOISHRIDVHGOYIFEGVKQGUBZAPLEHEKWWWQJ PFABTQXAICGWBQGGBXELBRQUKWCSFAAYUOVAEYGV WZVCSFHZRXWIJYZDVHSVIECESNYYEJQQNZBZLIZC VKNBZVRWRBTYZDPKKXZKVZIRRANOSXQCERCASULZ LCLRFNNSOAJCFOFEXFTUIQCDULCVWHOHVXUZLUSP JNIDEKYWCLEWXILKXGAIFZRHASGHTOMNTHMQLYTY QDXFKJYGXGJOKRZWWCSPPYZDZYDMNWTHPSYOPZNU PLBFUBQURKIKCSCEDOBSKTZJOHVHNRKNNZLYPJYE IPUKVPGVGKQWLTIFFOWEWWJLGMYXDLLHDEIJGICN QCSRXEVFRNMCSYDDJUADBLLCMFDHCGNKFWCUILZM JVKGFHZLUNULRYEUONRHQYSBIAGTWMVURJHKUNOS VRCUHGUDBPMTBEKHLVRVUVIHTMLMYKMSYEXFHQWW MMLBHQUZDBKLFHOXFZKSEXGHWHXWLNUYQGQXWKQA AXPBPYZJNVHBSQNWZUWIRMNNGFQKVAUZJEXJBSZP LLXNIYIMXSCJXUOYKPTSIJPPOOWPGRMUGSBYUKZJ XDZGKSVCMXZWRSGFIUCZADRWERZKLSAFFDJXOXXI DVAUOBERNATVWVZLLFGBXAYBWEUYXLQPTDSONIMV XYXURWKGEKEGQCDKSQCIWKAUVEBLTINSYPJFQCXO OARIQKSTYHQUZLSUKVGZYIAKEQONVTIOCTXMUAKX RBHTILUGDBJNLMDLISQJVAEUIDZHMPJEMLBNIJFD FIEPZPSEUJMDKQMXIKWGRVXIHINDMWAONCQQZGVC FXKNEFSEJRAEQWSPUPUSDYTEYRFQXXMSIGMFZXYZ ILWWVCKTNKECCOOMBASVNKHGTIGVFHQMSNQJRAJG WXFTTCMYQLNDYCYANMMNRACFIXWSQDUJTUIEYGTK EDTQVOEEQUXEUVWVJMESWLTVPCTTTCDPTUNAIBUD RUJXZDXEWMOXJMPLWIXM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MBPRPJMXRNERBCDSLBMNLKLAFVRSKXILLVYBGRMX QPAPSUIXILLGTPPWVPELKZZUZLFFCKPWXQGLGAST YDRDBCVCOEXWAKIGQAYQOURAATIXRQXBZMSJCRIP CRCEJHLYUCDFFPJUEEJQQRVZVBCTYONOLNBUTLGV KZCVNABSQPBZZCPUYYCBNHYDDURKMXZVKYWEFWVB MIUGUREKVDJEKFPASHEHURVTDWBUTZAKCRQGBASG CWKKACSVZCFREODJKSQCIKZFURNVFZCHRINYDWGU SBOSUDQVZPKDXDBQVXMLWAUUIMRKHRBRRGSOUPWU ZBBKSXZCQFCSTEBRRYGGIHYCSVPYOYVKIRZWRCAN RIPPXVLOLWOGSGJAPZRKAHEFEFJHYEZZQDSDZZHO UBPVCSRECOEQVJRBREKNBAPYVODKQFYYTCCMXMJI REEAMSIXICOJQCBMQNTWJUCGCWGIKDRDYOSHAXIO IONEGUGHALMHVRTCWSCDZVUOHCOZUBXFRVHVCVRY XIGPFNYNFVXOBKVUOYVPXDVTSHYZJYVIEURURSDX HTDRJLRHLGDSIQGHTOMYUTZBSOAAZSKRNAYKGVVY ANBXVRTWJUBZEEBWVGAVUGUTPZDHVACBLJJGOGVN CWUMAXQHCTJGGDBWQDZEUXMWEKHOSMZOKIPQMMYM AXICKEYAFEMISQSFVMJGFYODBSQPWUIMHWYVCXJY WTBIWINKXNHRPEBLSTCJWLPJWVQVVLXOOEZQKIRL QROCBCKAQXAFKSZMVEHCKXOKIRBZBTBUYTQUUDKJ NOWROWXKMQYLMOMAESTJGJMXAUNYHFBELOCCTDIZ XMAYMTZXDHEAEGKCSUIONDAWJNQOFTYQHNTHDKLO KZOKHJEDMLPEBLTWTYCUTRNSOBRCCFONFNESLXXR CUYZQSDIPRRIHXAGEMVGVYOTUTAEMIIPGLBCYZLB KQRMJQCWGIKIRTQRLQRGXWRUGFFVBTDTKUNJBWDY LSZKJISBRJOPDJYVDORBJEZKEHWMQBKPGLIEIVWQ DVTXVVEPHVPAILBAZOEIHZJYIUQMWDLGQOUAKCRX LKLNHRLDHBEASMDBJXTBIZHTMXNHWFDXGIRTTXMQ CXKQVCKETKWEGOXSSQGYQOSZRWGUGZFTXEOJUJVK OKFMVHKNSHZHLWSOEWBRMSVYSSKMRUDNYUMMYGYD UKRCMRZSGLNOSWTISOZDNKGQYWAYTWSQIYSWUEZS LCWCGKKQYKSOGIDPDQJAKXBSUPJXLRLYSZTHOBCD CXDHQPSUDLDMBBJTRFNFBTMUJDZRZACLDLPBLNFX WLLBKILCSLZAOADTDKUBBGOCQBMKFIMARMTGDHCO FEINHXRUNLGQXKTSAPVZAWKTGZYNRHFYYLLHOIBV THIMRTZLSZLLGKZHQMAISNTMOPHBABAOGPPYNQYK IGFWVJFWHNQSEJAYSTKBFTIVLRRIEMVUTOPTCQSP ZRJPGGLLLUXDTEQFPZXEDMHSFCHSSUPLSXWHACAJ JNEUJHBLDZWRDYPTATTRJPACAKTQNUDDMGOCZTDE PRFDLUPSWTCOUVCCXTLCVHZCVOOUIJXHWDPKCDFZ VXGZZZTANJFRTUIFFRRTGNCSMRYZUGCWIVZFGBMD QDQDMTXQSHFOPOXFQSYBPMKQWODCKGBNKNDJZVXH QYGXJXJOFHYHEBLIHMSJCVPCFBMOSDNDFYSAIJSW GUSMTJJKATZYYKTRUXKVPYWAGOFFMFGSATDPESLP SHTWMBYVNEFAUWCQMEFRTPVPQXLIZIOCAIQGUDIO FZNLKXJEOGKAWIXAIJQSHDOSQVKWULGKSQKKTRTG QYDPLQMIVTFRCBZOGASIRBHIBNVVGPETVXPLQKBN DQPPIIXGSSHHELSEVQDV
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RAYZXMDLAEHNXRELNPQYUKNYWKCSQAISLSWJTLAS QWPSBOIIAMVFVUNIXPCCSMEQIMIMOKOFCGRYMAKQ GZEWNKBHGURPAOOFJGOZXQZACPCSENCWWCTQDEVZ MAIJDIBVRUVRABPJRLKXNBBLTTBKNGFPXVFOCCOI BOVERNQCTNEEFCIGMTRAOLFHUJCIUNYNRDCNBOPN JXPHXTXDYXOHHPLDQALTPYVDESKSQMAYELXBTMHG TKJOOJMGIYOFYNSPHCUFBWRHTZHXIFLNUHBGODVX KFPTVOQEPWHJGWUSLFBCDICQVRYHSOLHZOALKTYK NLMTLWDMNKYPFCSXFLXOVQXFMNXDKSPEKVWDYZJG YVXKNNUXIEGZISBCYRSCPMDRLXCUFASPETAFEPPZ LAOUXYFSDWZMFCHHTDTIRLMXGVYURWXHWGJBVNRN VDIFJBRAROODXDBKEIEANUQBPLDLLTKFXXKHWSSF IRTWLPCAAMTBOKGSWQCKFHMOSFAHVSDBKXKSEAPR VRLHHWXCYZRKZMXDTNHCQRJLTGEDZQWBMUEFPDPX ERAPBTTUACCIQLICFPTINAVWZKVFACJVKEATVNGU OMFIKSXYKRIAAUQSLJMSGZOMNHWFKRJKTKTFROGK PGBFJEUHTNVQQINKZKYREFVOXMZZYSUTIPNOXLTR QCISKMXLBHIVWZOPKVJZHQOXMEHYTEZRDHQMBEFQ NLCZTFLABQITCIFLSVCBGERSOGVGILJWLERUWZNI XQCQBBMQKNBLDWSXFPDWMPXYOSSFVOGJIICNNNID YVNQJFTYKDJOMUODUQRHJUWCTEDBFIOTTYFYHTYO ESATPSDGUBNYXRZKZGBGAHNWBCOWTORODPNXUSMZ BNYHEMKHPPVBKDSFMDIGUXXECPJTZIOQFJMFSOTN HYNQHJALTBLUPZWJDIMEUKVFQYVKTFAQMWKUNXSH MMGQHSCMCRPZZRHFNXQBSDFEPLCUJFKJWUIJDRQS QHMNYBNAVZTFDPUTIXSESEEOIYWEMSWBHHVLDHGH ZQIFPQKLFWOMOCIAZGJVWGYLUHVPHYYMDRDTUNSJ HVMVAPIJCVYRFIWQWNLPJJQOCSXEOKMNSTYKSWAK BJPEPGPVFYLVMDKHHDTUXJNRVFMWGJKNVTGJNXSJ VWVQQKOKSULMCIKMDFCJQPOSGCRUSTWTWPKJGTQB XGPGLLEIAQFLRXNENBLCJVIPRCTZJGRESRNPUFVZ QZNDQHQXQVHVIMBSDFCBLSBAQBHPGMJGNBEZABEU HWXQKRLXZYKJKVFLHWSFJITRZWSAKTATSXJYKEOM SCVLFUAJCDCOYVKFQIMBMFVURJIQGJACJRFBYQNY VFSIYFOZUQFROUECZREVTYUFNPJNBRMJFGLWLKEQ VFXHSTKIHVZKPMZUJKEPBMLBYSYZLBRFLYTXEKMA AKRJDYZQCAGJYQMDVBXTDZSZZHZWOJWUSPEWIWSS HAUWQGQXATJQGDWAQFFLZUARBHUBPPGQZZDYTCTA ERLAYJJSUVHNCJXEPAIHGSLFMTDXUGHQMAKHONAB ILVLAMQZKTWHWFQKDZASBPFYCAFJWUURNDPJPZPQ CCYFRSIMHASLLJIVQNZTVPNRJKRRADKHWMMNKFBE EYODGGHDHLSUXNWWXLZXNFZZHXIQDESVEPTCBESO VFCGZNGMZSWOWIFOLTTMSHRIFANQSZXEYKPRVDXY ESWGOBJYPBZIZDQYYTZTMBOPSYHPSOAKKVDNQBGM MODLVWSPZVRDERXXTAVSJIFCBKPSOTISECMWPBEM FLJXFVKWKMWSFQOMUXMFUZLVDTWTCDBQDSGUDBDO KRNJPZVXRFGJFTRTXYCRHYBCQERZFZHDUQLXAPIZ ZHPSJMJJNNNGAYJTQUKY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YXEPKKTASETLMHKRLJLDTTSKQLNLYDHSTEHPVLNS DTBMQXHLKQENYEJRAUDLMZRXWIEGDEAFJOMEAAZI IOAUFJRYGIHGUZEUUDDZYPACERXIMQPIBOKJWWDR XWFNVIBDOZRWQEXTGBHLUHHGGJANJGCKDGIIXIIJ YITZCJGIRAREEWFNXTYDBCIFKFVQBWGQYPKYJSCX JKUIVSCZDPRQXRDYNWOHNJESFQPXGNYBOYQJIRPZ YYAOUQHYLEESLPSIFTUJGRXUXZMEZRVXNSMYZDIR FKUCXZDKFLMXCAJIDNKAJUWMXQLAPDOEVQIXUDCL JTARWNRNLBPTOGWENRNBEUTRACORLDCIQEMOAZLL UAWYWNTQWMMOHSWBPUTZHKBHZRGLMWYKXDBSITZW WFBJHLBAXHWHZQLXALTRNSSLSUCFPOZXSHSRZSAR IDBREELPXLUMSODNKNXIEFKBPIQUTJYFFDUAWOEE MMYWZERZALNYYYVEVMJZMFGDDSYRKVDGONMBZAOA QQPACUUGQRKMXWAINSIRTOSQEMLLOERJLGGNSRZJ GZOFAYJRMFCQHYXPYBLRSYGRWDUDUHUTUZMDXLWC PZHEGKZNARHFOBUNLQAOXXVBJEOLRXIHAEQOFDSY UPDCJCEYTOROLXUSPPMBUWHJJPMOFOWUQCCNMREN LWZUAYPZWYNUFXIEDVKWOUEXVMFNDEUHEAEQJEOP BZRNLFIUBDGFALKHRNXCKNLUUCKHPARWWSGFSYQB DSSQTRIZWCNHGQLXVKPGWZHDARDAPWYSOUIYSXZJ JULPYYBGXHMVJNGTWQNTPUYJEGXVCUZUTEHAGDUH OGIXEARVLFRGYTMHNOSABPFWXDBXYGKCYECOQJYB MRTTUIJADOCZYFTXAQCHKECSYXGKTBJOOAEABGLP IHISFJGVLLMNSGAXXVZNNJQVFMWSSBHETAJFAHRC SAPKUNHNZKNLIWQYRIPLOTJBHFYPYQZPSOHPPBEP TMPYHIXWCDJCSXSRRWZRZQGXLWPTNTYNASIFCEOC YXFNCBVDZFNFXKKDOFMNFRKGSUTRMOUMMJTWKXVF NLYPNISQGTMUXURMCDKLQNIJSIMRJSNQXTLYUYSV OSBFKWLTKWGRRJHWWVAIGIHJLZRGGYWFANKWYSSL HPNRPRUVWQYEBJMTQBIRYTEFXXPRRNNSDPIPSDSL TRTVVODRSZOCYHDVXAVGMGZBWKBONMFGAIREKYEK NHESDXZMHXZXVOHSSMUHJBSOJYWRBOHFKBSXCLZT LVKBRXDHIKTVLSLDSYZAYUPUSLANOUWBITTGATRV OMFZJTZMKZUXRKNXSYMGGRDTQINJTFTFSZCREQIR FQWHSIERQIWEAFZXBGOZDCEYVNVPLEZLISNKSXHR NIJWEJIEGBWOGPMUHATSITQEFBOHALZMBUDHWICE ZTPAUIPBLDLUUYQOGVUXPEZEOTKITZDDKGUZWEQU QUEAKCZVBNZFRNNIVNWRKZVOGDVQWMVSWKSBSGYT ZWXSGFEYEGMJTQXFHECWLBAUGPNRYBOYCDNUVMMY XPZPSEHDBZSMXNMCDAEIOBGVRUKIRJIBXJRLOFSR OJDJGOGVNFGGJOCPDCVVGSWQDYUGQAKLHLTGMYEQ ESCPSXGXIPVOGXMRHAVCKDTRQYZSBQDXHZHYNXKA RUYQHYKQRNINYYWSFDPUUHWXBELJYWROODGLYYZH LWGCSLYYNAQPBZIEXRDNWEMSMEGAONKEBIKZXTIY OJHOPAXCDNQAPSUZUFDPAYJISTJIPCZZTRRNTSUA XNJSTCHHYMHGONILBTLNZUWRXYSYNFJFQTISVIOE IIKDADHNCRETMQFOAOGAXGZSXQTATWFFANMOAKJD WLMIITBRTYTFWZLBUGKU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EAAATSZDSMNHNJICYVGBALIGNQRPPJKXZOIAHPJT MNONTLJIOBJUXOYGUTFYAJQRKIPBQFTDPIWFYAHU XKCUWGCQCTCALHDFZUHZJFQZNHEPLRTRCPDKFBQL EDMAKNLIYQIAFQJYVHQEBVGAEXHSVBDLISNSLAOB WLEFUOTAQRZDMKFMKKKTHNKOVYAYEJBNFHXAQKHS DXPWYYSKUZSYTHMPUJZSNZZLGHEQRRESVPZQGAHT XXRLVNNZZUPEGRABIZGQPIUZBQUDJOVVGACIKHUV JISKEJSANOCIDOLKTSCWDFVTSVCUGDGAHRXXCITI QTPOVOMTNVDGFADBPSIKGAFYQTEJGKUVSZOBUZBP EGCSOMZWXIPWXLEYLHEVZRUXIGIPSZCSOUKYUOEU AIOWZKEGQODNXXSPFSMCBFWELYYGTYTGTISFWRRX JPBRMJERFLDAOGXGHTNPRYJDFFBADPQLHPQTVKOP HIZULCXROWSLBZNIPBUQSFDQQXTMWHVBJQCQFIQA XZLGTMDKYGUBXNOSDJZCCURBVYHYROHDMFVJNUEH BPLRGLIAJULRIQKCOSATKNYJLKWRZCDDLHRFURSD FMOCBCEHTGCGHWRFEUOBUZIBQAYNTJHBMQSGEQUC KZUAENCIOBJKCZRRYDMCZEWIQKNOJLDYRMKPFSXK WODWEEWTORADSCCTNXLDBRZRLKKFNSWPCTCLNUYA MQLJZHJQSBECAUZVJFHEKJSMXQLDFDGSASAWUUKQ RKWRDKBNISBTPMGLKVYXISYYKWCCYBTWYGCJWEWU PSAOKFSAZFOHJUCHTLDWQBDEPOASEAFPGZPEUJRV WREAKLPCBBSEBNKIWOWKCJPSTJVGADKUFCZJVEPQ RKSYLUEJHDREADLMKEQOADYNICICXKVXQIHKKKXR ESUCWUMUERSEJZWKBKDMCDLHTCCZGIJZGBTQVCCD RRYCLDGMYCCKEXCZBKTUSFXEBTVDACMAOOXVOIXV WGGOUGSJZSLNCXROBBLRAIAKSDQEXBATGEZKLFRA HYVUNDPIUVNFEMAUYWAWNVXDKNFFDIJKBAITZMSK QDAPYMZMMQAFONZMHBLFTETAJXOBYINYYKQHHARW APXMHPWRWUSYGRLXAKFUFLEZSAARWLFBZSBCDFJQ ZLDGZMFRTDJWOJXKFADVLNPDTUETDTOREYSGHGMG NOTMOFKMXTATRWNVZSIUTTMVQNDBMVPJXBDIHGDM JGUKPWMNIAZJZRTYMWPKVIBMQNLVQCQMMUJVGERH UCHYRFZTUKAOZWWLHGAFAMCVYLJJSILSJSAPYNHT CQAPXQCKMDVSMOUOQKFDNWKCBBWRDAJJKMDWLAJD KHAMASKWONWVUTUYJZGELVRCZPPWMFXJDPSKSCMB WWTSMIYDWINSEVMMUAMXRXZVFHJNEJXYOXJDDKWY DGELVKMTZSXDDOADVVCZNCPUIGLBEKRNAOYOTNMW LJCZXAALZMWFIJVFOWYXUSZRQVOAXPYNCKOSXDTJ UBZFBOYXIYPPNXRJVMWZTMQTWVJIUZUVKSUMLEZK KTEDHAQQWSHFSHRDTVKNJFPZZUKVGRKITDDSJISZ GNSXMMFFZSJYYEPKWLCGLIHRMGFXDBIMCCLAAYIV UXXQJSXBIPZQVAIEQKCVQJTYMSKUAWJCPGLTZLAY DYLRAOYBLMTWTXSQJTBBWFJXWSVMJUAXSNATOZUI WQDEJGBCEOYJZHTDULTPQEKZLTPYAGCFWDTMAQLF WWASAQDWKMSXVVLANXDCQQBVAWWNUCXGJQABHNSI BUCJUFJPICLWYNUTYLGKHBUSDQKULOSFYLETDFXE YKDDTCPIJHJQYFYJRVFWBHDRRPXZSVUMIIYAVBML ZSCMKDMPDQDDCNAECAAA
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WHGBJOYXGPDKHGLEMMPKQAFRAWBTGNWUCKJAXBTQ GROSSXGWXYERFIXVZWJWCZIIVFZEWFSPSGSFYMFQ ZFIVLFESVKUNPOUFIKLKSCVITERJUCWKBLMJPPCG UUXEFGYZHUUZRFFBSMZYPAFVSDBTMXIUSCBDLFRF GJLSOPIENNUVWDNSDGIYEAASFHTOSGUVREYLBASD PVZXZIWEOULDVAGLKEALJKEYYHZTMLXUXRSYQCWI QNKQHTMQUIPHYMNVTLBIYTDJIBXGKCQEFOVZCOFB YFHMIKMJZNBGVHBULZHNAZYTVQJJWXMXGGLHWBYM VGQGMONPJLVXOHXBLOQYABZTPSBWPLNADIGVIECP XLBQDEOQLKFMRFMUPUFCBWCEXXVKXWXSYNRFRWXS MFOBGSVQWAZEGEGEEMOTHQWKPBEXAYIQLINPLGUS TFXTOQBNZAODUPMELLYOYPVHAULDLVCRJZESJSFE WZWRBVRRLMLEAKUNCLNYZLWERDOOSRHRQCVCKYAI WUMMZHRCGTMAQPUVHQJGPDKWLRUAVGPOCGPGTGCI NCPSIQFQINLSIGDILERVYIVUUQLOJMVJBVNBLXET KTYJDZDRSURXJRKQQCJOOBPWAQSGNTNHGULARCUH EUGHPNPHHLTDJGSQDFNEVQTHEAZQERBNCVTOKZYV KCLVPIEHUOZBVAUAJCDFEMHPPIJWTHHESNILYWSI CCZIKPOWNJOUHAGOUSEHZNAFEYLHLTIZTQUAWXKH HZHVOGDAXAJYWKQAPQCWUNWVWYWTCENSLDCFIJRG QDFVVDZSKMQRCJMOOVUEPDMCVVTKOJXHPQTYDLNR TOVGGPWHXZKAPWCQZTUIMLWNETBNPOJIRBACKKTR DDZFJGMUNRJVQGUNARWSICTIKQOMDZIWPVUCLZXA DGPNDDAXSYVGRDWTIRPMVRRRSHLXCRYTTTTECIPB DHRFCDSSFTNANCRYMDKXVJNHHKFZGSOAPIIWMRBK VMXKYYEJTIIZZFGGSYMAWPXACBKVYDQTLYKQZREX EKDGDTMXQQITCUPDCONUPSZRPVYRAGIAOENGSSTJ SEQSABWJQDQRIVUMBUUEAYQKCRCJQSOMVLJYVAZE RSFYNDVQKCKKUTNQYQIWPJCCZDSHBAVNIIUMZHLB FATTSSYSCKMNMJNQVOPAQYVCOGXFYOBXHHFGUBTB VZFKAJQUGLRNKKNECWZNOFUGSPQYZKDATQHIKASF OMSJQTIGZMMNOPFOPBJRVDYRUDVWGETTBCQKLEDG KVZJXSGLFLTJWLYENZRBLDEONKSXKXMIWNDMEHBG RNJCZUPEQHYEBOMPXMTFZTPQUYWFCECOXKHVGSIA TRIJULTBLOUFMRHMMNVVIYUDYIANAMIOATQLCBVQ XTAIDURPUIWRETFGVGOMJPSUNDBRVDBLCKOJMILC JOQZTFEEVGOJLDUPBDYTLZQLSDESSKQNLNWBMGLQ IOVZPZOJHSFGGIZGWTTKFEKUGLFJYDDYUVLEZFOC KNMCQBPTCYDWAQUDJVEJKNTPNERJNMEOCZTSFSKI CACFPZOSTAFRPPHNNSBMIELLMVSETNILFEAZZZQE TKHZZXPNNUDCYDHDLXKWDOURTBLKJMFOWMMDMPIR NRYKBHKTWNFFYQWXJIJRJWRZNVDATFWNZKBDOULL UEREVUSIOWKTKHWZCWSLPBLXTELJFPESOIGSLXRZ XTBWSHFIVXDXIUIDTSDWXADPNGPEJGGYGUISZISE QHNJPTNZCUSUEBGKGMNQORUHAPVBPCGOCKPANHJA QMQJYAGYVRYXWQHRAXGXVHNRJQDLEIZUHZCXCABK CWNIDGDKDXEHVWKGIZKRIZBCDSKXTWZLOGGAAUEU YCCMBAVSNJHARIIBPPXR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HJFWRPKCWXGZEFMXPHRCANXTBQRLWQKXXEFLNSEJ LIWPJZYROICYEBGVAHUKSMEKXAGEYPIPMKHQLZVT BBVKPRZFSXYABJYURFSEHEPPOIPGPQQKFVYOBXPH XEAMPUHKLRCDUFOQRTAJIKJMBAEHPOMAWOHYHECE VGFISSNKBSAXAMOOSEPZHREDYVFZJXCQPNSWAXXK EBCKTWJLBJUUXBSEDVIUTXMLUZCAJDNIYXZLWLJK LSJHIXZDZFIMFUFTCTQYZJBOCNNZVENSZRZMUWMB FIZECZRGIKPWSYGLFIVIJGCYRALEIBHRYXMBYLCE YKAXJWVTVPMNECNDWYHSFFWRFUABNHVQUMRCSZFQ QWDPYLVPYUNLRNIWHMEKTRPUYAFHAROTTFZAUUEI ICNZFIIFMQUATUFDKWFPKURESRDIYUHHNSDKRDTM KJOLTXQPWMOJOCVPVOGOEWBGYBYFWRBWXCRQUYTH TZLGYKUTLMPYOSRBHUECYWGKVAEVZZIRIBAHUBQA EEASIGZQMNZXMIRDANVQYFYWIRSCYJQNUTFFZGDT FLIHJWBFGQXECXSHSXRNBUWAWZXKCFLRHKOWBREV QWNSZYMVYHFZXFVJFLCOHIABNLTCJFKKYAPJJUGU FNZUETSEIXSCWTQVCRWKKGVZTVQXSWWUICYMHECL UUJZRPDRIFYDTGGJDCXKXGSHOBBSOTYBNWZVWUSD LHWRYQNVXQTLXPBUIGDJJZHIHXHJBRZXGYYZJQBY FFTUZGCVXXRQFNHAHUGQTLQKQYWMEWKMOUEFUULD AMVNYCZHWVGVOTXLWTWZSNMCAVDHAVLFYSOKJOJD ABDADHNGJXGROGVPXGMSIRYNCPYMVAQHMNCFBVBV PTCYWRSRHZFNGCFPDEGFPCPUGLXFYNZCZFCSHJFJ TQRNYCGEKNKNJHRLJHGNEJCUXFBVRMRQABLOQUAB RYYJFIFQWGUSYDSOVUCORWYBQEQGKLGYDFBTCATF CTSMWXVXKCJKOSXGRMYUSMKXQVQUQEKJIMEIDETC FFNHKNSTOFWMCZYMWBDOGUBAFYSKCIAGSUMPDIUO EBPANROKCBEKHUEHJOPRVZACSFGZBGWPVUKKIDYH FEOIERNPPKMUEBUVMPYVPCWZVPZGNAVQVAHDYYZA BGQFIYMLOJEAOMVYBCCXBLPHECCXTUCMNUZZDAUM QRAPDDPBVCGECNODPPQEBKDWTDTFTGGWVUMHACQE QNYDFYRKFEVDUOHLRBKFDNHSCWJCCKHBBXXYIDCY GJHZYIRHONKNXXTHIALRSSAEBYKQUKFJSMKVXTQV DCLXFOWRCBNQGYEHCCNOKSDVGLSOMEXYQTVOURRU MXABUXRJIOPLFUTGNZBXHBDPDNJPVPZZBYVIFNHH KWHGQYTSFZVIOSSMXWZDSFMPFANSZKMWNEIAWALE KEOMUGKAKFNFULQOYWGKZCBFQAKNEAUXQIFQZNFC RXRDYSKJSONXSZRZHKRJWVFKMBNAKEFDKYFMZGAZ HRVMURBQSSYFMOKRGDNVHPDVFJECHLGTALJGMILD SPQMBIDJBTLUUFLTULIGHKXKWPIGFYLRYTNZCBPK OKCIZPIOHHXWMTEYNJZPVPZXWVJSGJYIZLSBYKAB DBFOJNSNMHJFHVRRHUKUKYRMPKCQDFFIYRZMKHFA LBSMLBKZIANKTENRDGSYCHFJLCKQRFPIFKNFXLNY FKIQZRWAHJUBTJPDXCZYHCHTDVYZEBOIKAKZVJER UABHMRHZPTZRFQCDEQEPWTILMUCYUZXNUVREMQXD PWYKIENZQFIXYHVLHOWRJOEJOJGALCYJHAVPOZWT WWDZAOUZXUXOIBEJEEEJOTVTIVAXXNSGOWJTERJV VNISLCGWACUOWJBYFISO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MWOOYKGOVCWAKPRYRFZHWPILWDFZRGAXPQICCQEE WIUMCNAEXPCVAHLHPSJMUZLNPYVSDJKMPSYIVLSJ RALWIUYXDARGSAXGNAAFFEUXLAKJLZPQUAHYEBVH UXBPKPJKRTIFGOKXVXAZWSQIKIHYRXVAKODRIXII NDHVQAYOZZXQKRQJPEPZUTABCLALWAUILAVSBRNL ITEOOMDNKZNGJRQEJROHUVDLXOXAHMXIXMFCALUM GMTSRLSNLWQWZYNQMBLXDVRRKLDSJFPDCIESLVON BVDZQECGVFOZVZYUTAASIGUZFXGDFOSSHXRPTEGZ GOYNAHEHSQYAGSZXJMTJXREAYEBJVCWHIBTBVLXR SSHAROHLAFFLBQRQNXMWVEFJCVXPIDCHTWGQZMZM DTNMFJRFMBHBCNRMLZYHRYTOJPTWDBHMRWYBTZVD TAOGMUJJCEIDJBBEGWPUHZIGOIUXEWLCBQQENEHG TALDVEUOLAFRYVNWMGVSZCSZTUYNYURYDYQEAMSV FMPFWYJIOMHBPLJPLBUPWTUPSBWRNRNLYDVJADDB RRNGROFKUZAVWBSEMIYCNCTUAHGJHMERYVFWEFHJ GAUJIXAARDHILFYTVGIGBDFKERXYDKEFWBFUTCZW XVXEDXJHSSXVKZMSTANFIETOEROTWISQVBZRJFPP GIKADIHGWWASBWUDXNZMSKDRJQIICKALNPWPSOGO OYMAKTYMEDMBULYAEYDSFHOUAJEFLGQTKEEPWNZZ QYPUJHYAFCENELFCMZHVEMDMCDDQYOIJQVYAUYAJ QFDJQADVBLHUWQORQJODHVZEZIGNWQZKLUHKNIPM SIDTRNZILUAWWDNCEHQMEQSZTBFEEPNXVKQLUAPX LEHLKJHYACLKNXWMICFHNDWSRWSATFDTLUKTUMJS WHUCZTHZOSSWFVHLDUXWGHRVLTLKURYPCVZXSRRC YEEDZRPHWLEPOOAPBKCHQTCFVVPTEITDWKYCDFLE GVBTAQOKZINVOBJDSBULPNJEJPZFJYERJOULWUXE AXQYOFTVCODBEYNNXLCPTZYLGAWMGNMXFTQPJWFH LQEMQPACCZPJSDVWWPDAIQPIJSKFPUIBXQYAITXK CPWDJJTWCGLIDCUVUZRKDRZTHUFOHSDTQENQXQHX ITPTZLFUYSQUQCSKDEEKCNHPCGFSCVHYNXBEMAVH ARWRSZEYVSQBUYSNFLAMGCMNQPUIIBNLAIZNDETR EVFMOCSTOVIOAAXMNURSFJKSNQNMQKRBWRDPLYGE AJIWVSRUQFIQGKYBCTHRFLFTUGVDQDZITQDSXDGU TAFYCYBCHJSGBMQWXPURUEHDGWPOJGJJEKSEWMUE WNRSQZZZPLWWKFZFECDKQUZRBGZINBVEDIKZCBAN BLUBZGBFSZFGLCGEOORTSYCHXOBMDPGOYTXJXQWN ZNFWKDTPNOSWSMOLMUCLCJGHSGUHDAFSOCHRJSPQ KWHESEPBSNRENQWKZERQRZACQAVXXJRDSGIGXLPH UVRSTGDBQBIXSETFLEPXAEXAFEPAHXLSCQQNKFLN EAKDHCMKTDLIZNEWPIVHNQJUUIKRUFAJZQXTSVXE FQJVLDJNCTLVIKSMOMHIFOXYGJYKCZKECRGHBCZE HNQPMQHQGMPVTGAYTIJLCKRFXFDLAPFFRVLUHNGY DELAIRCDZCJEADHDZUMUDBDXZOALJOVPXQPINWFE WALBPTOZHGKXJVXTUTTVFZMHKVJUYFRVKCALTCTO SAISKSUDNVUKBCRTLGDDQKQIXSJVVAATIXRNQZRB UUZDBMPJFVPLWTPIOBUYXJXXYRHBGIQUGFSCMQPF YANSDOUEUOTJMYNIVUUYIWUAKBZHZMUKBOCJCJJI PWUPHWNBTLLCTPSAEYEV
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SRJODKNHHKWHLDRDMWKEVGFBZAMXVXHQEUCSOFIG BWTXZTFWEKYWRQBWQMTBNBBRRWWSACPXIHWPRXLC JIXSAQZDMDMMDUPBHSECBIDZAGVFJTMFXOPSQYOV XALSJQRTWITRQSQVYOYNRWEBZFYARTKGLKZUGFHE XWNEQWXNTYMKYUNPDMZHXUQOGNRMABQNRVUUAFLA LKIMYQHGVYCOAOWDFMNFUGKSZNMJYJLBDHSBYGCB UELADGWRGHWHREZRPDLHUBFFWHEWKUULZBCVNRNE QERXFSUWZDSAJZWLNBWYBBTNTWLIQRVISABTBPKK LBTLDBCRWJANYIQQBMMOLSUHICSSUGXAUFBARCRE ONNSPQISLYUGZWQMVCYSRILCXIKAKTMQCYFRONOT NMISWRAVTHIXBPGVFGPCBIVESFFNIBLUAFIMNOVB MNSNUPZBYNZLJQSOBGKHLIEYAPJZXJKPGAPTFFYF EPEMQKWVNVUJWWOCHUAQGIOQFDCXJIXNGDRBHISB TLURHYEVRUURFPNXCYUMUYBJNACAMTEVCSWIJXIZ QZZBFDUVFTMINHNZWGOTVUFEQKNGDEMCOWDMDMZY KLCEHDYSKYSXLCERDQYEMNOJYLSVLIYRVRFTVNKL GAQMFGAZVYJCCPRGXVCMBJUDONKODQRHXVZUBSHU GUEZYZUSNHFFATJXHRFEKBLMGOUNNEPCFITCKIIQ CMEXZDKAALPHPONISPMNPAQIMFTSUSYYXULYBUMZ HWTCRDGEEMYDYVASAUUQNHCGFZTTNCHWSRDVRZZI ABOBHDQKQEGZRQVKTBFIGQVPQFNUMRVTLGZGHACO YWRIVFYYLPNGGZYPDMKCNLRZGDUISMZJTIGSRHZG MRWOQOXSHJGKOMUMCPMODRBMEQSSVWYTEPAIGMOX OUJNZKPBFCWTPXNRYUIWIQFXKPJWLNHAZLYKBIIZ DYEIQIGXIQIRAISYOMACNHCTLDFGDHISJFPDUISF ZBBPPMSAIMMLYYNISJBBDNVZWLRVMBNOWJTIUOLM ZDGCNGMGYYJNJQRXZGUVXWELNLXITNSYHVHAXSHB VLLVFLOLHWYMXIXDUZMIYHCUIJOXLTTJLLZGQWHB OPXFCMJXRBHVWOIOQQSOKEFFDVYFXXXYJSRWQVCI CJCDWVIEHMTCIYCLMWGPWREIFHRAFRYTNUHFFVPR QAVDYWCYOVSYVHWOCHDPUBICZAJXNYHVXMUDRWLX AXHWNGRTJCMYFOGBLOTRFNJLNVAZMTUEIXKUKQHE QQASFKZBZJMPARPDEKSMEESOOWJEDGVCWNARYXHB EFFNWCBLPAJBDQCTKXUTHXPIWLUFHQQMDHVNKYFD KERMBZBWICDBJXXRAIYWXDCTPZEBBZOJMZDVUFUL BAMQWUJGHXCGFKEKMWVKZDQICSAIMRKIZOJXICSG QRJCBONJAHQCWPAXIOSXRPAOLRPMETUCKRHKDVAB SKVINBCGMOWOABDIZBPHYMFLZGIDIEXLUGXXGYEH YXEERAJLVOBMARCDXLDBNSNNLNCYYNZSVNUOGYPR VVWXGGZZTJBGJWHEMERRFCRKFPMDFBWDAFYLDSSQ SRMSMBVUTBCLJRIIIFJZVKHWARVWGJWLBPRCLSHK KMSKLAGRMTTLRFSUMTWXHFOAACZIUQXQNNVKSCZV XYQIAZAOAQVUFPTGNUBXEAEPMVPMFGSDDKXZWPER CMSCNBZQXYIPHJWGSGVYDZUTBVOREUBIDHFPUBDE ZXOLYUWOSOZVRKABOXBKSOXWMIOIJFYKPVNLQPHH SLUPPNBRLUMOBIWPATBWVZWBOCJRIGJJANPMMWPZ VEMMGROIDJCHGLSETNWHYLBNMZVJYAKQYGFWWELY FAZOOGPGGRDCKTJLNPOZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LAMUAJHNBUBEKWLDOTHLUMWKXSQAHKDRJVLSQNLR BFPYGYTFAEXCRUFSPUDLXANFDYGEFBHWTNGSVQOH FYXNRGYDONLMRCUGINKBBAGSOATQQOXBETFRAIWQ ILVEVMPDCKFZGBCUDJNMPKDHJBNKYBTEGUVMSWZZ WNEWGYLXDMXUSPYBFOOLAGGHPRRNIKUXIGOTENPR CRGBYHUSPXEKFDLKAIVFAGHEMBRGXQVHNHVQSTMS PSDYYHELUXAQQWDUTYYGLQEKPRNAOZNYSXEPPPTG HLRTGIIXFAXSOCLMTBEMRQKIVLWEYVSYJOSXIBDY ECGDFIEZPMUZRQRPVYQVOMBFOTTVGAESLWZTPJAG QOZRAMAALEYUJIJYMMRHJGVSUFWHRHNWRHXOBBIN RHOVNNFYCGIQYQCQELJUDWOIVWNEVDHURVVMSOYD KEELMMZWTGRFRSYQAYJKVORWAGDNXPFVRSLISYDV AHDPYSLQPATKJOGTNODPPZGPWFGQHPAMVRJFGZJD MYSEJSBYUVQRYOZCXVQMQRUBOVAHSGJAPTSFNYUB VZZMCSDOGZJNTNWDTMQJYYRQHJHURDYRVPUPGWMW IJARMGNUTGDOFCPUQHDEFURJPJSHOBFNUGDAEFEB XSMGTVZUTDOVQYZIAMTOSNXNIEVCZVTOENYUZTTP FWJBPJISFRKUDBDDJWLMIQBAUCJAMAGVATQNOOUJ YRWSZFDINAKFHPSIQDJGDZMWXDLTAFSQPJYYGLVQ CYKJWITAUHKDPXWACSRAQGTBRORVVNZZRFQRJKNL IZZGSYDZJEOUXXHCGNEJQDZOSAYLHYCSCXBEHOFV NEBSMXCLGRTQVFNOJRCLHHYTSQBLOTEDJQIZBBYA ENXPWIZHMDAAWQKJWORHLOESIPAYNIAUVEETAWAH CNNFPVUNAOBQWVDDNTVDNIJMPDXSOXSMTXNBIPXG ZAKMLQPREHEMJBVMSOYRFGTIVSEZBNOTJMPUJYOC RTFTLAHMEHWPWJOGANDCOWLIASUGVGBIAQSPTADL OAXXTNVNLMASXDZZKCDEBOWPFMAVJITPGNZHEFTT JKVOIQUOBYFDADXHHRTRVYKWYWFCPSYYPHWWORDT FOMUINTZDKQSZQLRLCVUUTNSJAIQVODCERQCMFME LSMAEGVLWAVRTQOAMHOSQDXCKBFSYAVTKPNWRPXQ CGVHUWKXFEDYCPSOUGUBZLAPIDEKGWIBFDDHJFXH GQHIKTMVXBMASANMHVSVEXVIEJSDWSXKSEPJRZID RFDLQQOZJGZANWDQPPWOAPQASUUAFZSHOYCCQDYF APHKPKBKGGUTLFDDBFFAVOXCACNKYRDBFDTGQNCR XJBYAVQNVXZMHCGYXHKVUZOMBTTSDUPGSJJEAJQT BMOGCGPGTFVSHSXDQXOMRRPQYIWKOBDXIOFOTPZJ SLADADFHDZWSUUIOHGZNBQLUBBNGPPHWFUPZSKON ZGDLLGZOXAJTOVKZKYGDMUJUAQLMBOBCYAQMVCMN ADYDOAXSWCXIFUQUHFFXUBWJEGFHJHAZAWAIGXCT YRMYMJORKSHGEBUMRTQWZYQUWXXZEKXSOFSUGUYI QRESETUVKVVANNHOWUWRPZSIYRGEBAYFIKFPXCKS VKTOWQMOIFOCTYKLLRDESNAGWJWESWXZLHRWCRQX SEOJVFNPPKPYMGFISGPOPGSUKLZKDTOMYWZDZFCR XMQIHUAPIJENTLGMLUSYTGDFRSDIWEBJAZOWZACN EVWASVCTGSPBYFMPNLXJWKPZPENPADFHVHXITIGU SXTDENMIRRAAJZVMDKWLGKYGIEGHQULTPQBEGJUA HCXIPRERRSHWFMFXUKYHKVYMJKVSNMRWGVSJXZFJ DQUEHEKXUWGDNZXNRJUJ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YJMOZRXXWDLSFJNJESOUCWJVNTPSTTKVQGYUVZFP CYHFEOEMRYWJWBIYZEWGPJIHHRRRYLFWRKLRPQMG XSVIAJJHDFSKRDADKTUENLZNSHYAQBDMMWEIHWMB KBFZCQMTADLROCUEDKAYXBBQUUHETXUHGBQCCKQQ JOVALBJORDNGQQWFSQCHSNNXTGYNLJXNVBKSKODE BBAWRONFBFKMYDOFFISLROXMRKONCIOLEQDMDIBW BHPUJOXPXRUPGNZJZBKRSAGOVFPDWPJJYAAUGDTL MJDXRHYLJJHBUPZCMACRDYNDTAFEWLXDGWDVGLOH TUNLLDTHBBUXPKXDXBLPZWMXARSUUQXIMJFLOPPZ QWDOLIZDRHUXEYWWZMWHNVVIFSMZITEORAQJOZIG RAFBWTWXRXNKXAIQFQSJMJXJBYDYPVJUEXDSSHLR PYWGXFUNRDDMTMTKBZMPUTKLCIUEOPLTXREFLNXG GRNYJPIQLZFQXDXZKCVTSMOBZOZRYUNMDYHGMEJE DSPLABKDITJELORFKIXMWPMKBSJDHOZNEIZOEZAK YWWADOLEPOLRWWQOJKUMIHVLGDGOKMQQEDGLSUTN CDEUPDOCROOJGZZNYCYYNKGGAMRFTEKKNNOXFVVL CZOVYSIKALYBZIGUXYKDHJSQOJPRTTDVOUGFGYNJ KNLPFMTVXDBJEOYKSCXAKIXNQHGPQDEHVMITBBBI MAIMXJMJUMFGLTSAGRPQXBYXXSYJIYWFPNXIOKNQ CFKHYNZHBUYGXLEVWXGWMOFQXKCNXKOYGSVEISIX MAHOJIXCQKGBUSCPFNVCUKZWJAQCOVRJJXROYMEK ABMPFGXTSICYUOLIVZDVQYHZYSUYKPCQOZIMYBVZ IGBKKVZMXMIFFGOTPHRKSSJRQAKYFLFZDGWINNEW VHXPHMZQNIWZRRNWOPIVREGXSCQBKPMXGKLPKWJN EDALUBYLWATYALHYQDYMJETRXRQNYIKYZQQAERLK NTXUYFFWXLFHSGOGTJCMXHQFUXMBVIXFQINZXUHF JVOFNFCCHCJJIXNWDOBWCAKNJVZTTTBZMGJZTGQS XOUGQWSXIEGWICRMUJGHLWIUISHEDVIXJWVRJYWY MOOATMFATJOCZXHRIYKFPTUWAXOHDPZXNKROYIIB KGPGUACGGMIGPATACPZXFQLYWARVBCMYWLMWIMZU KQIEQOIDYPWHUATARQNNWTFCTIDPKGWRKEGYDXTY PSIKHYTNVQBXORSFAQNBYFNTHWKMXJEJTCRUKFJM NHJFNNAAZDIDVQXWLLILJKXQUYLXYAFNEBMICSCU QKCJTGVAMBMFUFVUUWSCCSBIKFLQVLSDOCCLSSJI YHKFRGBAIAONZIOKIQVEBPSVGKBJWMJFZMMDMCRT MSMJLDCRLBVAHVXYZPSRTIJYYRWFTXNZMWFXPHUA PGZZEOXYPNCADJULSRGNIBPCVTFWZXDPFPLVEZWU MINZZYMIMADMBENHOSPDJIMDYBACIBQOMTRWOHNQ YZRAVJIZVFNQHYFTPGSPDDFEWPVNUYPCJYCJRCCR ASWNCIVYNHAWIRUPTUCRRLLIEVQUTQICGQCXRYQF VPLEQYFPVYKNQPGUYTSKCDLXXHTFVAORBHQKGSKC RHGYXAUNAJEZTDYMNZLRRBZOJFZKPFAHPWYLNGDX AXVUWTRZSCMYKHPBHDBIPCVGHVJOQFEGPAVQQTOB KXVDSUASTXAELYVWLUNOMJBOXYCMNZTGHKBGZIML RFWIIENDYIJUPGIZULYBDEUNIQFHYVVBRIQAACHL UOXSQCVYCLGXHIITCCEPIVGHZTDHYQMYDTQHTCSM GJDOBLHAZDJOVQCXGAQRLVAIYGTLENZLDBQCSNLA GNFWNQNIVWMOVTOHPEAM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DQWGYQHXTBPLAMNBPAGFYSIUBEPPPPLEHHDMGYLK MZWUAJVIKWWQKFGNAQHWVCPGUQJCWOSGILMFVDRI MNYZQCGRQXDAIVIMIPIGXIYKPPZYLKYGGTYEMUKZ JIOUECKTAWDNELGMATHWFQHMZHXDVTGQCUDKCGPA BTGZVMRWTWAHMKBFTZWGGRSTFVVHFLALGBDEEYIZ JQXOJKKFJEEBUMPLEQQGHIANNUXAMZSBYDENWQYM IHKMIBSGGGALOELCVEZCWOGYBZWLVZKMWWMDSMQV TTMBPRVZNHREJPQWPHKDOUVPXJMWJASGIOMGASOX AQLWEXMFPOOMDXJORRIMIISYZNWPYPFOCNITMVRS RMMAURRHTIDOSEYVJKDOOGIHDJXJZMUIRZZXWTOF DMQJHXVSGSMIRHVGIEDWWJUYAGPZPFKUAKUBAEWK ICFPDICTPQCNBGEDTQLGPONHYRAMFWOCYKPDBSIR AYRGIFBDQIKPLWXEQNEPBYQQUBFWGSGRLWUSDZSC DWPITKZQZRQITSOMWUAILFOYMNXFLRMTEDEGMLHS SBKPLOLVPUQGCVRYFNKIBPAUSFVDJKNCLTANBMWC FOLPMVSUVGAOPWATSGKSKIUWCKZZGZCOVBZJCVBL BCUXETRKLWSEKCZGBFCAHGHOPWIBWFVGSHGLFYTH FLQRTMDDQSFPHVDBAIQHVGGRAICJCXCRMVDLYXXS LXHMPLSKQSHYSOLGHMWXGURSNQHYTNOQWKUBJIHP ZSZTPELOXNPSPSJTELAWEBVAFYMGKGOOPUMVLXQT RZOPSEZLCXXUEHGEMIAVQJKGIGFBZKLPVZWLJFMU FWZKRLIHLZOYWMANTCGGBWREWXIMWWZUZBWMPBGL ZEAHWSSZYMDSNZWCWOKDBZJFTNVVESAFZHAKOOIB EQPVPGDHQQEHJAUCZFSCHYNKXPPDHWWCPPMRYDHW RSMCWWZZFPKWDKAJBQVUCHVFJECSZYPEMSFYEKBM DNHRMCSTFWBCCSKADBFWAUREXGEDABPTGAITAAYK PFZLFYEQKHIELFBWZQMRESCVJSRNKFRVERYNGMMW SEMPJHFXJVTNCUACVFJSVLOGWKIYUXKKDLRUHQNK WHIQMHVNGPPKJLAEDRDIMZUEVGCUAQEMDCMQKPGX BGWUOZJQLMVIMZIHEISXMIVDBDPXBZEWKVPFQKRC MIJXJNDPLNHPJRDNGDNZCPPUAERBLMQRHNMTWPOV BZQZVHGPWUBNOZXRIYHCXSDAHUMIMFGGRSPBVGUU BWXNOOXZEGPDKIKWIFOEYEOIREZJRUUMTEUTNLTM TYNRQCIKPWLXESZRUDVNNBEZZOOZRJAEHWVIZQHH ATQLPNIGXQEGIWCDQKVCHWOFPHDHUCONMIRZEEAM CBVFQCPTDVRGOIEUPVTWWSBQGSBMKUVKRZTVWRBH CHRAQLOCUPEZHEIWOKDZAGIEJMXEYWLVPXFQXATU NMPCOTKPWKDZITXUUHSQBBRMALONNFVOTUDZXMYT DNKLLLGHMSPOZSSFNGKSSEXOQOPEWGUUQJHEFKBK EPEBNJEQTCDEAMCMEVZPOTWBATMKCWZEYCUNMARP BFZCLGRPNGEQXESKHWQACDWUSAZBRSAKOGWSLEWZ EVNIHHBDJSYRAKNCVWRBYRVVDIYGDLYTSNAQOOVI KHHYVUIYWDRBRCZOTZCDBMIJUUOQQCUSHHEOLJWZ ROSBLUPLWKVYFWTSTNOVWQKCTROCFXEUZBLFDARB OKVQUFKITXYYYDCEZUBKVDFOJZYWCVNZJXXNXJUC LLEGGFFNIWPUINGSNERSVNGSFRQQZSTFYHJXZIPQ LLOGCVTYJCOBGVQZYHKSAKAVSZJDGJBFTTHEMARO XUWWPXCSLUZLLESKDRNT
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FLQUTTIEJYUYEKONREUFFGKMXKMZQRBWRVIAMAQI MUYSJQRDQFAHXPAIWEUXFEAPIXLFFEGRFNOLJOTO EDSXCUFCVXJYPFEGLDMNZETXWWZBFWEMRJRHLYTS MXNOPKOQZQPFOITLLSSTIRAUJOIOVGGOLTCZLSXB JMMHHAKXVXYVWJFBEPYIVRQDCIBJOWZPMXQFRHKA WIBLNLWHRVPIOWIZYBSMHHZWQUIERVSVKTHSNZXL QITLTJRLORIGITMWQZXQWDRWPJNUWRNLVVWTJPPM WKMYNTWVBSMHNFKZEHYFCHMDOZDUQAMVUHGJIXQD YJFHNDOPNWIALCRLKKYYQXVLHPMFFLMAQPDVPWTL BVJIYZUCQWNJBCHEYGAUQNGIACTBDIWLGSTSUWFS QGXAGFHWGHRDZIIPIPOCKJBDNTQCFSABEYRSQZYH NEYDBSQVVRFSSVGPVYKLOCGYLILBGODPEHOMEUJO SGSBEDDHOQPXXWMMFXCAJMBQOIBAMXWNUVPHGGSU EOZUXPCGAOUYBNSBQNVXDOBOIESOUCRGPBSXYWNM RDKDESOQKQMNNVCZAHHMCZMRZJXRUGXXPOIWDSZH DJGOMPLUSGKOORHUGVQXWTMSDHCPIQUQWHTHGTKY APQPFTSZLDBZESKYRICRPMXXGZPOAJGVGHEJMJDE VLOYNJFZWFIOJCWPSLIUDTKIOOFFRMKEDZDKMZWV MEUEXIVFKLLOUJDIGGXSETYYGGNDOKQRUAOXLHXA XKVLLQUUJMEOUAOAPJDLVAWGUFTSXWEXMMHVPDBT RTJJRLHIUIKWRZOWOLPEXXSUWYRKXNPMULDQCWNW WTNHADIYQBFUUIRQMCDXTQYNULCAVEENBJNXRVIO SKMMAPJUCFMUATVAHWDGIHZYRVHAIREAOBHIFWNT AETGSPKTCJSQGPADJEKRAHFVOIYHKPYTTBUOQUMD WTQRSOJSXZWWVTPTTJJCFIFDLRZPEAHUEWYTITVM EPCRELEYLLQPFMWJVTIMPRXDUTDXMIRSZKMMFAUZ PGHZNHJLFKBIAEKGVMZLROEJJAUJIGCGSZSCDKKU QWKUQCKWOMAUJMWPJNBVRREKROUDLZLQSJITINRH HGKGBLFAJOSTWRXABNLEBMUZLUYPTMGQIOHQKNHZ AKDJDGJHLGJUXRTTHJSJYMVICHPDDLFRETAFAZST NENZNRDWIOZTUETGTLISLNHQPDOPDHMKYRHOSBJR QHMPZTCIFWSYWEWBLDPSWBZEQFYOIZDEJVPXPFDM GKJILBLEMGBDBZHVIYNRVCQGAQPUVHPDQFQQKTAC SQKNULFCYFPLMPAKVKUKHASRJGOMXJSGUHLBRWDX MGEGFYUHNVXPRYKPFUSOZVQOBNKTGRRAGYAYPTRR DQWGGURWTOGZRWGTIGHIDFLWVZSHXFAMHBVRSSYL MZBCICCAIGDNEKNPZRIUYDXQFJICFGIGTARAWLSK DFQAADBNCPLPOQCIINDVUUCNDYVPGETFSCNDADNE XXRLXATCIVMABUXTFUIEAWHAWYTDYODJDQJMBYBB FSZHGYOGYMBTMDEGYQZZGWTXWGLPMKCDLQLHRKOG MILJECKFBGDAAEBUELCHVKPFHTARPOKEBJJKAVPB BIQPSFGDBWECYFLRSHRJCPMAUMWCWHRSFCTFGUGK XARBKLKOKQNVFJQWVELGOLKJPKOFVYPEFHCPVDHX NFXSTKTJEZONZWFGGKMOVJFDVWPHROHSPBYPRIUW JWDEAZCNNYYUBYKPBDHYRLAWHWKVYBGPMHGNWEMR OELJCSCDVXNCMBXILEKGZGMZXXZSUJYAHTAYLWOM YHDSVRBAAIHZHUNVDKYJIEPJOYHJKEKFOUUDCFWJ EDGNPUUVJSLPIMZXPBED
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      CIHAFQQZWHRFJCKRFCSYYIQEZPBKCIEJTHEZHZJS XFSTFKLLQPSPDYBXFRNTQQNOPGXUQLCMFBVOHGAP MVXEHCUBXKYZFHKHLUGFULDGXKXASCZKXIQFRKIU XSNMZIMMXTGFAEMOZIUWZFANXPQVJCQPSLHXKEFJ WTMNROPZGAFYRAUNUKNAUCJAPKCYKXVNZCJYIEIU BJZDPWPBDJCLHNONTALVTROJHBPBJIAKCZJQVOGT MSVSEPGDESZXHAQCACDFHBPNGFMAOFSLWNULTMBV ZAYIYJRPCUZUVZBAUFKMQWNAEESQKLDTGBDHYFIR IBYTJPDWNFXRBDJIWPBOGOKZYXLYGDERRGVADVWM JGVWCZOTBMWBSDXMLZKHIGBEYHGJDEIRMHQGQYHX FIZGLUDWCWAYCWQAWUTEYIMFFMMEHEBALAKWWRKE AVYSHZIXVAQMJCFLNPMBVBAQRANZDHWFKMRIHOEM CPZGYPXWXGKJVQJJCETFURRXOBDKOANUXZGMWBLH OMJQBCEYXRYZFUQFTLEZUOHKMDVYDMESWRKIFKKJ VHKISMHROCBCFHQOXRLFBFHXWNIVASFXQLCGZTVO PXEWQRNSGEYHOIHNXBYTGZHPZWRZMCOBNRDTJYGK SZVXFRDVNOLVSBONEUXBBTUSJNISAUJTAYDBTYXK XRJPHXEXZIXDOTILRJFEVNEKNAWAYHZWRYHLEGSK GGJYXYELYUFUARJJSSSXHTRQEPVRYWDSHJYBURNU QEEYLAOHRMJRFTIQUUOXNGADETCDNSKXZGJUNAON HZVLBBLRIIVEBTKQHDCSUKSVQVFBYNBAHZLHYFJR VGOMMFPOFGDXIZOJTVTSVKOWEXYRMFQAMSTHOURE SJRFHPMKEPITMDGFNBKYLCXNZVTNGOIQFPWSBBPG QKNBATRZIAXIQVTNWSWHUZNKYSUHXDXVTRHORZJN DCIIZXJMNKXGYJIGBNHFFWOTFWPQLZUUYHPBAODK TZWEPOGVTAMAUASXQOAQOPEOQIKFLFQJIUZQROIK OOSWQWENOPUHPYXQUEMTTGPWFMRFSGLCMGMHTRLO MMHOYYGYPILKCUDLSUQHLEBBCUSYVLYCRHLTDBSI NYAMQRNLJAKQJUIBTBTGHYNVLGCCLDMGTCVXABYY XVLAZDFZHXTMYTIJHYAMFNBHGOKZJMQDQSSFEGML UFFJRGVQNQBLGVASYRBEKXWYTMRJAAOZLIZOCZGJ RBFYILXBVCREZVHTKHXHQRGDPBKPSMEVHAXUCMMZ FPKGOBJPMCXNOFXXPEDVRKGFFRKOOCDDRRLLVVGG QULPDCRVBTIPOLIONQLVWNMYGPPFEWBBVDTDRGOS ZLOQJIZKJPMMZAQFSSUZORCLXKESVIXOMSLUNJOF NMXLJPWDFNRPUFAHSYKBZBVPRLVVJWFXWBAWUMTK CVRZDOVILGHEMESZCIKITLEXIKAILRPZBXQMAKPV KOIUMDKELKXWSCYEYPGRKQMHAFTWUHYUMRLWXTSK XSJWGKIMISESNIIOVVUZOZAGRYQZAQPYFOCGIDRT CPPEYMFKGZOFSCNUNZXZRXONKFRYROXPLFCXNVOF KGEEHRGPOOPFAFXYKPXZUEWDFFZOOJXRCBWDCYWT QRNAHEXVRUNRIBNQUSDLBYASPFOOGYBOUBTNVAVA TDILSLTNPLLWVZXWTXZPCNERVGMHEBDJXKRJBMLO GOXEIJAKRPQMXUAFYTVTECVPYABAIAHIBUKGKEAS OMNBGMTVANKPTQMJOPPICRXDIBIQWRJEZDKNFUGA NRZJJCRBQBEIMNVFKAVONLTKWXVWECPFVISOOZAY JZHPIJRVKTBIHGOSNUXDRXDCQNZJVMNGRAUPRNXL RWVMWWHSLBWUMAIYSZJJ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QIRPOLQXMHVEYBMEGDJTIJHEJUHEGNZUGZCXRPSE KWPYMWXPBQWDXNGYXKBOWGSOGOCVPVUANUSODZQV MNPNABNQIMVPCQUGDAUHZCQVNFAMKJHGENAXNBTG JNJLPLXEMSVECQYZKDXWIPUPVKNDARAVKTVCHHLV SJNDCMRNMJXTMZPONIUSAEYODHZXUCYIYGFVMNRA FYESDOPTUHBZGLHSJFMUIHMBNWHOVAZKTOLUCFAL CENKEFFXXHQEWMASGZVNAIVWHDCDHMRBGHYQISRS MWLYFKFTFZGEJYRCMAAKAXZZCQPNOCSEBJSEMBRJ NXXUEUHCPFSDEOWAMMDTGRUPOSZXRUGIIEIWMVXE HGOPUIRGAWJMXTFKIKRKSHFDYSICPLMCGUBKIULZ CDHGFGAFRXCJDPPGWQXKHAMPLCMZCJXDLEYZTPOO YGGKSRDBNPREHRCLPVTQFUVYVPTLZZESYFKTNEMD IGPMZNWACVLMNEZIVKHBZBIUTYVLMVXTSINDRUUG PXAGOIBTPLVPHZXCSNPGRCXFRPQYRGWGZSIRIIJR VPCXHEXTRBMIFYXSUIPVOTMJLGXRILVZWFTCFLUL RDSZYGNJRYHHQLIEKODQGRXVASKQZYJXYEMCEJMB GYEQXLIMHHDGCUCXOJZBZGSQQNEVZYRDDGKROQDE XQZYIKRRKJUUSZZEHLZVHEDCTEQFAKWZELCREQTC YYULJLVBBIVCULIIEFPMEKBNGONHDNVYGREHAYVQ SZABOMHHVKOHOALOUIERAQHNIBGLGYHLSJCARMHT QOBTFZZZGQZKEEYKBKDUTTKMMUGETBYGSWNPHDDI TGSDTGHNCPJYYAJTLMCTVEZUZLIMXHCTEFDFEFZC ESFNKEEKSRJPORDKUFLJWMUJCVIRNZGKGHMAHUQH KIJLAARTGSPMIITQGGRQIXAXWQNXQAGCLYPTMOIV BFJDOSZDZMRCFMNNCWBQOKIWZOOYJMLOWXAGQTDB BNXKAIAHOUTAXQOJLIFOETZJKCLYHLMMCFVNBMYE PWKYCATQNJNPUMHVQZPZFTLMQCZBEHYNSAINZUXR XOWHSXDCCJTEVVGZOGETXKISZYIZRSTFUIABXKFK JLJOUHLRWREJEFDINSALQFPMKHCVQKOWKKWTVVWI HMANXBHJHOMBTRZLYEZRSSSZPTANWDOKUMWIPBRN DIHPMBRXHYUGAZMNPMZJKHGZQHJPQIHLVTJKLDBS VKTAVRMRKYNMMBWOIJJOBSOPBDGRJAIWAQHHTQNY GYNHBMTNALXBCKENIBDNVKPKMPHTPTQYCSGYJQAL KZVYXMOTHMYYPAIPSWATYGSDIDUHMOITPLHCQLEU WFUYLPELDZMRRZFVLFRYORVMABEPZFMREDNYJEBD MJMIACCGVMLWHXMYUDYQZOUCIXYKDPGYOYPQPZPI MBFVBTRABVKQJLZSKFRKLBUWTPRJECABSRPUHATP LGLQALERFYNLADJIEJRKRNPSTOVJKMMZWFPZFYBD CSXGEUPHJUMWMWOIUVRDWYWNWPMNYIVWWDHBRUMK ONGPSXLKZBCQPKDDBTQQXZDXTPFDFVCKGVYCQEGR SCBFBOMNGKQJNGWEFXCWKDDMDQIQLEJEJOVYMIMO OHKOTTBRPINMBXZMCCJBIYDRFZFELSGVYZJUSDIL BIJRRAXVKFEGUOYPIPIDCFDQVLGEJIOUDMAKBNGN UQCLTQWQBDYPCLDMAGZDHCALEXJKTOKFUODXNPKA UERBZLIKXNUSPDSKZUTTFHGNNOOFBUHMORIDLZCV AIKRSYIEKCVOVHRYZRYTPWRATEXNJRDZYQOIVUNM HJOBPSLJYPSFJIOWJWXIDFNPJRJCHZJNKXLQGZUI ZYWREYTHERWXPMUEASHQ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OULYSDKBTFEJXNXAEYUZORXGBLHCWUHIOHHLBKTB ZCYHQUUKRBPEXOHQVSWSNIGUEKRWIKOYBQQVRMGK THKCZEIXEYOIEZUIIOGRZBTRIKCMZHJLAXYZCDXR AOXDVWGKKUQOVVBOYLPTRWZWMVZJOTYNQPDMFBUZ HBZOZJALZFENDUSLMJCFZHOBNMSZQHZKCZANJRJS MBNJCTPJCQYXBKMQRWQVRVWNWHZNOXXGYXNGSSPF NATVFBXXYXUWKJDGUDHNGBRDYUMGBRCAKAUUADOP SCQYJDDKNKPLMZYOQQCGLMZNTIFLJBSUCLPVQCVI UAHWHHWIMZTXWTNPCDXIHLMGNLBTVFCMACAEOMAY KZVWFETTAXNKCAUPJBBXQECNXIVKOBIKTUWERFZX DLZWUSNMISZTKJFPRGOOUDRAXXGVOZZJLMSRFYZI YSTPYYUZLGUSSOUAPBLHRPLWEAHEMTEBTOULUZNA GZKPERSCQEZGKHGHVCSACTUJXUFPABRYYBFQDXOA TGZNNZTWPHCUMKQMLTUCBMCGLJBZGCYPBLABDAVY VMTJFKHDREDJZJGNPCQZWNEYWQQQWIBFSSFWPLCC UPUGPBJUSTFTKJSMLQIGCNLSNJJTGXXUJGCOHFFC YAPJGKMBKTWJDBFWKEFCLVEIMSSGHZBULRYSRGEJ CJZIGWPDVCMGDVLJMACAPBGIZTLXAQTVFOHFGWXF QYLBBYTWBMTOCNJRCABYSJKGWDJXYBZEHQAADSOE RBUXMMWCNCHPDGSPOKWANSOWGAEDFKVLGEMBNVJJ TKRCVYBLWSDBYMOMLOLQOWJJYUECOGENZEWNFVMC ZWXFVPPSVEBHYNRGGVFMGXEZAWSHXXRLVWEQJMBA JVQYRVAHXMMQZCUNCGGOAIDVASXLCRILXWLHYOLL JBQGDYBDRVJETNAEQAGPMBQANYMIZQCZJKYEZWSE PZFVDZQWGPAVOCHYLSZFSWXLSTHSCSNHRAGJGJQQ TUISHALMDFAMTAQTIJLQKODXYFYSNQBZNKCKGFGY YSRNSQWBFMXJUTPEZFOLRMSIAONRWKICRLDFJDSU LAMGKGJZJFLNYDBJVLNAOZTNWUMCWBQCSSARAPSG DHRHZCYVHHHGNCMTGQKFJPEWSUIYWQIFSTAQXBTN UVIXVVSCFTMRZEPQKMRHCLJDOJKMOGDQHCWYDRAK FLAWGUONUJRQSLBQXINFOIEENTVXWNNOXUFRBNKQ APTUOSPUWLUANUEDYQTXUDSUJDXVQJLZQKPLMBLJ BQVSTVOSKOKJJWGKFZZLGHNBVUGGTKOMWYGEYNHA MLPLQVYRGTCEDFRFIINMMHNYLZZCHTAMYMUGOHIP DIKXVGMZBHJAISEPZUZERKAWIVCUIMGBXRQGOTIW CUKWGDZFUYHVTPTMSJGYFVIHLIYXNAGZJVEECVPZ VGWESGXBJQHFZBSRBUVVJHHUDDXIVOHQPDJLTHCQ GPDCQTCJTDMPIIEHPHRZGNDJSIXZMKAKFZUKVXYN PNPWZKCJTJHYZDPHDVCRHYOWRVLFUIQDGMDWMSHC QGMOSXRNHVYKBLJPFNOQYKGKXECKEQWDXRLFOEUP VMZLBIAMBIQXPJLNYKOCXEGGJPEWVDYWUMZQBWTA XHJKEZRCPUVNYZFWHPCBONSYZABESGWEOYZUREBL SWAGTEVCLGCNRSPLJLNLCAYJHYRYXQWPCXFUZXKI ABGFAVEOCBHNFXKDEECNJSQSYVIZKIKRMIPRJZYR CGYKVOEAFLNIFXERAWUGXUTMDEBSRRYNZLIEIUAE XIXOZEQEYHZNINIIBGUDGGAMDTJACPYGTPBWXWRB MYOMSPMZHYVQWSJWBJXDEVJDHYHMXSABPCBHVCSB MVRNOKHIOXXPXWCHVZUG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      IAPWBVETEBHKRPRCWNFUZPSXEIVXHZVPFLBZMFNF XQQPDACRIOHMUWBPNBZKVIKPLZZUPPCGTEJRZEQE CYAQXJEEVPJZQAUNHBGUGADRSVPFYBTSJHTAPWAY HCVKTPJECTOEBSBASYXGZDBZKUXUHMJHTSKGMVBK NUZFUTYAPNWMVGWPFLLBSLMMEJDYLAIPOAPSNCWB MMCEQQTYXSCWKCJYFOSIIDBRJLIBFTEUPTBFIEMG QIDQZHPIIJRSKLWQFTYZUEKFANZIKBWAWZNGPNIJ GSJQMQULGSHYSVXUARCIOHVQKRKVOZOCKEFUVNYQ OKTTYQWHYPILGCZWJSKVAOLPHNXNYXJSBRCVDQBS AENGQXUFKOZFWZTBWWGIJFRGHSXEGNOXPCOSJYJJ DWDFZBUDFTRFSBFZHTGOEXGPAIHVOEJKXCNMEQON QPCWHTTXRMIZRYBTGLZTOZQKMCBTMWRICIYBIPTI FFHFUBLNZVZWLRBDLBTYRSIGJOPWNLDJXIOCVHIL JKFTTGPFPSKFDUQDPHLFRNXOWFNFQQOWQPHXAJXW XNNRGUAYYSANKIDMEBDTQSFINMEAZUHIYXZGWWHL DLRSEHGXFCXZRTTBIGMIIPRKHYDMQFHNDZTGWBKJ EBQXBMOFZCRDOCKHFIZYUQZVSHAZXFNIVPAVXUTU KFZBXVQHNAHHYGMXVPNCAEGDDKMDENFCETKDIDSR KCAXHGLSDLZKAXHOXQZXQVMKOVKEVVZFXDOWRHDE EUZTABDIUURLLWJKJMMFIHKMGWRBHDINDPLPBWST QSMDXJZETYOOFDUBIMYAUMADOAWYXWHNBIFSXYOR OCLGTFQIBYYSVENJNJYQXFOJMXJCZTBWQYVTBFBT GMTZXSPUDRRAATSWPWFMPHITAYRLCTTCYHFGVJAA RPWWNAXZRKZJFKIRCQHVVASSBGQUXQPLSXNJBZFY DUSPDJEETMBHCJFMVIGONZZNQJBJLSHIETDZHAYZ KJVQBUBSLAZADQBKXKYSWTQUJEJMSKWNNHQAOBPE YTAGRVRTSEIXCMWJQDDRTVYHVENQYVNAQMNOYLLB ZGCKECAXVUJQBIAQCHPRTNZPIQNPJUKLJIZXFUIF FRNREKTIJAXYNQDPVPUCKJVKCPPWPTFGRBRTGLDM GMRGQOLMJEPLQOPNWNKMTVHETYKQFZIPMPMTNTLB YIVXJSVFHXHEBOJULDLDAGZWKYSJCMCQQPXIKVXR CJZXODJAMUXAVNLEIKKEQHOLWJFVNBWWCCLFZGQD YZTBHFZEDGFWFPXDSSHXYJELSOXMWBTLMCZPZNAQ HCHDZTYDAXZACELLUSFVPOXJLYKIZNDVOXDPQEGA GPSMUJGESIIDXZZAOIELNWTHKWTOKVKNUBCRFUPG FMIKSXSBMNHSOWQTJSYIFUPYDFACCZPLRSSLVCVA WKZQBOMYFAQXDXHFUUWFQQQTYSGHBXKAABMKOASM TPRHAXSXYGWPGNKHKOGBGISRFLVNEHFDAMTTEFTV XEBEKWBCMLSUWITVNEOEZTAARXJLJMOPBWBFYWBM ABYQYLLYRHVGHUISQUBUNNNVTYMXPJUJIMHWNVFR VDECUHWNPPFQVHGVZQPUQNNZAKSHAQJSTKWRXVYF TAEUMFSTYFGEXJJSTDUHREQDAHAWJNGYPZLRZUID QMIHGZEUPBKHWPVYVDHJTYURMBJMLGOCIOEZRICX IMELHXWULRPUUMQFMNPRLZSMXOIDTYCOJDXGDJHR PVHHPQASILRLVOGRHSBKMNWMNVMTMGUTIDSJWOLX SZBXKDOBGTIMMYMESELMNNBXCGNLEOSMQNSJMBUV IGPTDSZUBLMJFQTAMIVSFNOBOZQSDMNEYGASLRXT CAJFHEOHDMGNYNGCIUXD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JMJAOUQNUIWBJAGSGJGAGYEBLFXOHUDCWMBUQXAY VBAYYMEXOGDHZDMPNCITOMPODERTLSJSXDJPKLYG DMQIHJAXUBIBPTICWINQZIZGXXZGGUJTOMMPCTCQ DIRVWBMARCXXTMZNTKCXSPAQHUEMLITCRDQXNFNP NVUSNXGATGDZWZYQJXEQDLUNUKYZPOATIUBNRXWN FYAOVMWGWWNSCRCRGPFNZKSLRSNAUWFFWFNWIOTE FAIFIUKDRWCVJGWUVNFTFQIVHSIHNKNKNGERSNNB VCMNFBPRXIKUWMAOIKFGYBFGKFCHTFMLJQYROOIV VPKOTVZEYIWPUUNWAHRUOEBOIAEVTPGGNYJGUYNQ LYQWRMCPFCXYFXWZRQZBUETYCRECUGBGDGWQMMXO YXARZLTPZIHTPPJQOKGSNCWMGLGPGLKBAHUHTYPK TVPKCTTBYONZDMTMAHRDMCOGANIRGCSWTEDWRBBK BKWRDGJJWCWJCUSSHGAWKVQEUUJTHSHHORVINTJF NFVEPHQXFHDBURUOCVKQVPMDCBRXUCIDCRAFCJGX CHALHCZLEXBHQBQUAVUZPKEUALVLITWVTHMQLTGM SWXPVOWYTQILGQIZQHPWUXENLCNDUYUTUYXKGDFV KBMUCBIYBUVLCSYYBSKMWENWIFKFITAGNKUDEOYX UPDBXGRGOGSWNBESGEAEOWXGQEQROGKCJTKHUWXG RKNCABHPWNITKAWWVZTHGMZQRZRLYSAFPMHKNPVN COWSLPPGISWCCMNMVWGZMFIVUOCUDRMZLSTTMHZO XHUDUGGRSRRGEWGFZECBFUZYUXRFXKYZIHEDLHEV XILZEFSKEUJKIQOKFWXAYQJWWVPZBHKMJBMPHBAE SAZRHRXDRVYOWXHFKUSPLICSINIKQJJBCEYMKBUT KRLPWPQGKFGPKUKJJJZVPHQJCJSCSGAAMGGUSFFA LTTLCMHXTDTPNOKMWELMPICNSWNUOXWYOASEVTSD DYGULZEIMWKODDNXRDGPWCFRGXGVIQCYNSQXYVPK SJJMQXBROFONVJESPXDSDCWAUHYMXHPTHYICJMAD ZAVYDHLIRNELKQZGIXIATOSZLZJDBURJDGVXMYTQ HSTUYBWEWLFEAOVIBFRXQHPALJKSMJNYCYEPJWNQ ZPPOEIUFMMPGDIBAHYBSGVQLYMKUUVHXUBTBGJMA GUOJYXDZBBTEPXRZNTYADWIMUXOWQJIRSSCSCBLZ DQZVVSPYKYYYJHXSZVZAALFKVJMPNGBZKWHJHSGY GDMITIONJQGWTIJDWNEXCBBANIEAJZEDQFTCJRRI XJGHZPGPTPKNOWIUFAURSGZQPHDWUQIVTGAVEMTP BNCTOAMVZPLYDYHFAWASDIBVIVPZOLCYSQUKVJOO TGYJHAAOHEDXTTZDXDJZPUHXOWGPHNCXIELUOKGL AYXLRXEUEGVROIHCBJAEXZYJDJECRVQIDMFPQBQH TNUATYZHASGGLEGWBIMGMZRPPIXUSQGILGZPSGRV EIVBXKBQARJMFWWVEZLSBUXCENOJIOGTUUYGSTEI COAJOVBPDPPWDHFYNUTMWLPLXWGNBQOKTWUYKSLX ZQNPBZFOPOVBQPXMZCHPNZVGRAZTSMOXPERNJSDM DYRJCCREWMUKLSBZLVRCNVDOZJGKBDGXOIAVSAKS FLSUYZGJUREVIPSXJLWAXBTOGNMWBVBJGREYKZXF MEUENFKPOOUZTZMCILXWJWDNHLSCVPUVEUCFDGHW QAWWTCELDULTEKQJYGOGGCPZEZHSRXYRPMOOGCNF NCENZYZHXUCDDHNYFZCHLMHYYONTOOSLUJOMCHSD OAKCNXPNNIKRHYGKFEOGSEMFFGNNIECCASOPDZNF PTRWLTADJQJLKFYNDRDU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RZPKJLHROEIYJXQQKTUIJJOIGRWYNTYKUJLXHTDI SQEQYXDDPYWBCFQUGAPQHJTHFUROYGMSNLFUQRVC YFOLUMAMUUODHWEODTAUOINZRXRUTOUECEXRNEZR DXNUGFOMAALGVJLGXRHUAGGEARZODUIVZXHYXCVY RPQXYOVUCHKVVGAIRZMEMNFYVQTOCSLTGMPRKNBS UMMFXRWGGDALGIVOMFZXIPXTJZOODTSBZHNXDYTL VJFYGKZOECKPWZMREOBQTVBTJURDGPOPSINTQJYF WJHWYBURSUSULJIHNNNPTGTNFTBZZCVQNOXKXIHY MVXJCLQOPYCRLBXQIJMDUGUQDMBSVGGHFAGDGTWA GTBYZCFESMHOJDESHBLODDPEQFTAYIMVMTEEHYXJ MTFYCJBKODBBGPFRZGPTAOPPHJTLALICWAEISBOU QROBORJQCWXLASTRDHRCCFITJPDXQOJZRZIITFUU GBGGYLSWRSMPINYTHESGJBZVPDSMEPNLUDEPMXZW RNZCYYEHYQESBSFSDIFNVGXZFHATGIRVINYPJUGC YZWKBEYACLQDWSBOFAGYOIGBDNOUNWKFTOYVKRAI CNOFFFKNHJVUDBXNKVLJYJQBNHQYKSJHXCLEYAEL OYPTKAOQXYBZGKMWKNEXLSEDRGIDOCLUVAGDLWOU DJPKPEYDRHQPWPVIMLUSTXITKDQGYNOUFYRAVMVL DDCZKWGXTWHSYPIHKEBVSULTONGSGSGBRDFALOZP LPNISDUHBLCHOILGALHZQFDLNIWZLROFIWWIAYBT MLBVRDOUBMLEXZFISWJJAEIGDEZEDOLRAAJVERXZ JVNBWHNNKFTXVZHOUVWRAWZFBXINHUOZLRQPTRCG TOBWGXTAETIYNFSYMCHIOPPETJJQCXCDZSERLAUN XNTQDLUENKRBBULHDYTGCHKIJEJTGISHNKKVNHZG DVFTLXIUHIGJUXTNVBKNEYIYYIOLQJSPLTYDDZSR CCJOIVYKDFHJINYWRLCRCNKXXXZEYMVKUXEXXZZE CVECFWYVQXGTYPDYKGHDZNZLODFATVNNTJDZMHQW YPVUWHEJKMTAYXZLEGSGCTBOUCJGJKCDUBQCIFTD CPXCKFPQNRSXDAYUQWRCHTSIWNBUXPKYRDPFKJSB BWXVFODPFIHNKDJWGGWWFNGLWNSMKPFKCDNQQZKR HIQUYAUUKHSXCRGNVYKIPVXWIJBZFUIPHNKEERZU TKVEMFGFDHEEXHFANCMFXOYLSKKMUVLEMBPEYQNT HUYUWTKEBEPZYKMVDEOEICHCKVWTISIHCTQNVQAU OATQIGQCJYAOVZYDQXDXIHQHBNNSDPHJQDUUFSOT FEGSAAEHPHVEYCNRMOPUJYFCARYPZKXGIXNEJICH IWBXNOHARCOUSPZJRJDJEXYXXIZZFJGFOMYTZPMM XSJXETSNLZELVXTROIWCTDONNUHHRKCAQDAAZDHX XQNCZLINFLZMRRXQNQTWRSTEVFVPWILMUVFPRGFZ GZCLGZDQWCYYMFIEZPUUSCXWAZHRVZAGVITCUINS SQHYBGORODDRUMKDQLFUTPNWZIKRLMOGISJKVFCG QYWNXUVXVEAEBYCPHZUIZRIJLXKVVMYXZPWJRKTT PUXFALVASRUPMXTPEFAOLPSALQPWFNRLLMHYSPHQ KJPSIODVSOZCTQRTMGIBAVTBYUTKAHTCEYBTUAIQ PKDWWKADQYGUNDGRTEPRCCCSRLASECWVJQOGDXKX RQEWTWHWFZNEPSXGECPCCSIPRLNDXAICHLRJQYEJ ECYKXFCVKWAGZLRMZAASBPXNLDCEVUEVOMTGHTFV CWYIGZEWBQHVHJAWVHLVTIDLRRHMILOUPWMEBIDC WMOXVEDVVMVDOMWFZDIX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OEEEXMTIRSTAKJWLRSNJNKZIMYIDAJUNCRZIMDBU RMZYRAQLMJSJIYJSSAGHSUKOGYQVBGXHUZPLUCJH ADSCVDMLPWJXEDQCUMWEDUDSQPKACFNLRQYZCNVD VOQTMPSGAUBXMVZRGNDNVVVFBAVMFVQTRSMODSSX SEZMBQOCJUDAMPWDDJVKRCFUJKUYUIZAWQVQMZEE TDDCSSKZPKILJYPDJHQMSQWGBCBHEWNZKAPQOZYS KWHYDWIMZTCVTXFGQUXDXZFOJCKEIRNLSHQCEUHT DXETGFWOYLKBSGFOADEAQZRAIKJWUNZMWWFSIJID TCSZYAIJEARCIGKYBZAJZVQJBZOVYUEWEZLURYII LMALVUVIPNBUEREDEUNSJFNTZJBJSQPDBEHKBPII SOXXAZIGIATWLIVSANEHNHIPZFJDDBWWIYVTWTAK PSUBDOWVIXWRVJSXCGLSWVTUTZGNNQBINVKXCAJI TPAUPDCBCDULUZMJVMCIUFBWTBLXKWUMSYROJZZQ MRZZMRXNAOKJKSFACTMKZQQTVPSERLQVVPRWQODV BFBNDOANYXQVTGQSSTUVLRPYQHSCUCFKCMHCOPXU WISWPLKWRVCMFQWWBSJBSONXRBGRUQDNSETJIQXG NRDJIFXGNTNRIGPDWHTWXPMQAXTEXCZDEPELBMBS UCTLAKCRIMNYOODPMEPOCELBPKYEQPYBPSSSMGYX XZORWJGLFEOJOTURWCZEUYWARPCOTFAKNUWYKEGO PDQZXQOZOYJDCSUDGNGKVANGHQCJFQIJWKWRUBRT OHBBGCIQPULXNDZKEZDTDKDWHDDALZLAMOLZNRWZ MLSHDXSZHHAYUXTMARHBYDXZAEPNETKGSTVQUWJI HXQFJJVHMRPVBQWELTRHSLWFSRWRNIVVTHCOAPZD YUJJMVIPBMEXFSXSBNXONSZRBMCZYIOCIFZKOEII CJUFYDOJBSUUFEDOVQCXPAEOBTSDELKPVWJYFVTR BZXOOZZEPXBZNYBQBMIYMXJICBCOBKZQELBOOQQO KQPRZEWRRQLRXEMRRMXLDQTWTNJYLCGDMBVYXEUY NQNLRTBWYQZOOXHBABSCFBOVQHKNFMRIDAHWYRZO ANDSPYOJMHYAQJQHHWVWMWDAWVEINTQGCFWIPSDX RTDSSDVOLFVUADNMKLQSGGKDVKUUVUSRHGOPAQXQ LTDOPVPBPYSBXHKEYZMODAAJBEOZRTCAZZLYPMFR HGIWFSMLRRQUHXPRYSLUMWDSWCTNXIDKPOAECAMR CDEBTZAOWAFFXUIUVDVPDCZTYIPYQJSQAIXEBBZS CGNJKUIFLMHJRBHGZWKLSUQKPVPFKTGDBFXCUJPU GCEXYOYEEVHJSJKLKVDXWNQKBLSJLXLYDYMVFAEY POPUUJGIXUODFEVEIRQZLWTUPKFNXDEUFJHSJKNO BZTETYSIAAEGFLJPTHJBSYLQDKTHVQORRBEIHQHH MOADJGXPTLNJXRYUGDVFXLFZFZFLZVQOHVYEZXLO AYFCVNQVUQEVMWNHCPHYHOKUBLBZOSHBVMYRVPLN GNKEBRVNWXEILZUUZYGDNFFAHMVHPVHVTDVGKHBL UKGFQIHZOVHZDIUWWJNMCXMMMHMRWMTPGPVLVEKJ CTUGMFXHFPEMTTIVNGXVXFXEMJZWJZKOHQPYWTRT EXAPCXWQVOMKQWMMPLQKFSXWGSCIWICVXLJCPSCO VAMVOLEWOEHTXQVRZLNXOTOEVQQQMJTMHHKZHVLI XQQNSRAWHSULXABDNFCXCROATUYKIUAZDIFTQVDL HYFJNLMCWXRDLCDCSSBZKEULFHWCDEQLAFYIFRYG SBVECZKPARCFTQIBASSJOKWMATQLHAAHUCCYEPAA VJBURGFLVCTVTWCYUGLI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      VUEZZGVAWBVQTBHMALZKBSUPTACPLCXAENSHXPVF SNMDIVXMPJSKTQLFWNHIINGQRVSKNDUFJCARPRXT KPFLHKFKJOFDACPJOIKSWYXUQNODAQIUWHZUFBIH VKKTGHAYQXXMYGAETPNAYGZXPSUQULHQMDLQHYXZ CWMXGXEACMYSUQUCHPXHPRFNLLWRMFOIIJWTSGTE DLZMPDSCFWDRCWLHYNIMLVCWDKEOPHHBUPXKIVVJ BRGVBLHNLDLJTSOWDLSHKMTCSINQKARKXKUPKNNG ZVJMIMWQMVMIRSAKVANFDZHUYMCSRTBYEZVQNXXN WSTRSRDFNFFQXQWAZHZLEKRFNMOUEZPPTLEHGVRO ZYQMPBLMQZKXELSVCIDPSTBTKGBFLKODCICBAGJQ ZVIXTCMKXELORZDHEOHSITEUMWTFAKHUFOPKCAWS OWELODPGYNIDFXODUTHHTNCJLMZIKHGKBGMXVWQR ZULXMDVOBEXOUWEKLBCWTBGPGBIJDLESGFEAIXDG LSBNTSWCXDGDEIFALXGEQJRTDJTSMFTMIZBABZHF EQLKXZAGEMTJICAXWRWZNYRKSBAILRPYHHDSLHHV NVHXWEHZVRCUTMZDFLTHQOLMEQAYTQRSONSEIHOS QIMGGUMTTMMNOPZZHFQYXXFRSBDRNOPEULVNKDHE NOUILKKTZEJVFELWRMKFYPOTFJJFOUHHQQWAIYIT FMNLGQREVXSZDSFQULGVWSZHWQXCFTPBEWGSIKEW GXIIVNTLPEJNJSLDTZQCOUIQXHWRWMBWWJBNQVLW AJKHQOOEPCHEBPHWEQXMQMOUXBJIZRKBLNZSACAC YCGEBAKTDVMVCAZLCXDJDOTPEHFXENDMSTUHFCHD PAMNJIKKWNCQSWTDKXAHADELBOEXLAEYNZMBCUYE AVNKNZBXTEGPOEQGZBTUDQLICESTBHOKHLJTUEUA BWNBMBOSVOFEYZBCJHMTGNXOTZJEZHHXGBDQWTEA JAQHKJDTHWLKPTIUHPVEWIUFXBYNHIWHXPDCNTLB YUGVEYOAZDOVIGCULGPHQOLSBXKVUHAAMRYOHHAX PSBBFPCNYCBECZDJYOVEBBEULENQJPDEPOXEBOIP WFSKCVTBXOZSDACUYJAXFVMYXTFMAPAIHMXDDSRL MGDSRHBJMYLQRHRSMILOZVTUDJZWEMCSJVBJKCMS DQPUVLXFOHDTUVUANZZUTXCWVJPKQQBXHRWZENBL NUJAGZVGBBGAIGAINFQRQPNCQSRLDZUZKUSEODEO RSGEEIMQUADDYWCSQOXDROGOIMAEVKZFCFIWQLHU QWNBPBRIKBUAYSJTVKNDGMYYHFEZNCRSQKPCOREP BGWAKVMZBJRHSZVYCZIXDWCHWCOVPHUCYVAVBHQX YBUYLCURWGYFTLWIMALBPNODJJWMMAFJORRCCWHI LDVEJJRHBLACUVOFBTMCWZZYPIJGMDLSUNSHSXIQ FDXVMBTIPYXDDJSBWCIUDUOWMRXIFFWZJLTIDVBK FWTQEGRKODNFWXOYRKYLAHHFTAYQDPWDVSCTLKKB CLZNXXSZBWFZUEMYQHNCAWDUOKQHTCWSSHJDTRSP GGEFFVNMZXWDOQCZUPGZAGDVPAEZAUODAQRJLOZA ATAAXKFDBAIOSRGMRVYQRAQWOIZHQZIVSWFTJRYM QARRSRZFLDTQEGMCIVXRVKNCNLUVHLBOXWQOSHEN XKDZOEKUMTBUBKXOUPUONKOSUYBUJCOWKAHTAUUZ DRFXIPFUXFKVRDOOQRECBZTSUCKIWZOQICNEDRWP FXVFOPTJEVDFTUIYUSNNVXZWMXYSEGGULCYFAXOY XABIOOICGPHFKOZRPSKXFWJBSQIKTISSKGUUPFNM UYDLSQCCLUOPDIPOKIXG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DFYCHEHGUWLZEPKPBVLNJAMABLRTCNNLBRFMKFPR FCFIPELKMGJLXENRPYXHCRGQPKPZFQGTBWTQHRAX VKXGYFUZJYMMEBLESUQTAQVWGMUHIQZXIFGYUYMH LDWTOUDRYJEBBQBRNZOUXLUMSUDBHFTTLAFGZFCQ AOUUAIOSLWKKSBKYJVXLMUYPHRMFSVXBFRHNTDFW WGHTSCBAKITLUKPBQMRCYUKPSDWVHGGDTIVYQMBP QGQJCTVBQPPLRKMSHLMOSKTUVWJVLLVEUVUWMLUU YVMUQSUPZTKPHWQCURYJDFMMSUGWNAXXEOLWPAPC GGGMWURYADFKZVGDKDFBBJNTORPFHRRVXQCSFBFH EMJKAZROPSFDEWYHPJBVYWUPKYOOGGAVLMXIZLJE RWMSWPZWICGXCXKWOMPFONHHUILWTHGHKHQVCJRV VZABXNDRPDXFAATXISTWANKUBZLGSSNLWOYLHVDN OCGOBDFTCFVWCBQYFRVYWNDQEPBBOCZUOCOLOAXD WHFABMBZQZVWUGCARZDEYDRTKDPJTMWWWXOHSSBO OCZZUTIDAWFUVULGRTNITKQNUYJTRTCUTBRFRKKV JDKMJNVHVQELDBKJSTZAVDZLLASLLWFLAYKHGBBF CEMNZJZPQTHARSXYZYAQRAFAEWUPVCXXORULURCV TEHESXXCNEHDUZBKLXEIXDMRYNKVAFCDLUYBPVRQ CEBMUVNGVELWETLFTOLOUNLSPPHQUSPCWSXUIWYT KRKIDNTKYCYEDVIICIOFPOKXFNBPLTYOCQRDHPEE CCWGHRXOERIKRIOWHWALDFXQTXOWOVNDKULQBHBZ VNUOBOJQZGKAMUSVMEWPZZIMZTOORSGPOFRUVVCC SSQLSNCZNNFWEUEFLGIBJKYTELEKILHBQOSQDAPO WGWASFCVOOIAQVSAFHQQRXYAAHLZVVVNKZLHKKBU QAVFSPCRFMOPVBAIPBKKMOVCYOUPHJUQTBCIUHVD XDPBTGPVTLSXYOPXSKHABBIXCJUFHBLJYYGAIJIS ZHNVHQEKRQBVTQBKUEROZRPIVZSCQEHGOMSWQGPV OVFSHWQGKEZEBWGDCRKZDDYNZGWOPADONHSIYJYP VNRZFHBYTVNGFKZBGHLSCCABWNCRLXWFEMSYZCRQ PDLIUPUSVVIFZNCPTGHPZQJDKCGMSXZCUYSQADNF QCLPCOAUXGVTASNJPOLQEMXOIVDYIZTCDPVTGMGI BXJBRWEPZCGBYZPTLDYPYDGWVKOQCSIKYOCEMAYY ZVOWZGDRRMJGMVHATKYIUOFMFNRMFHLIPWPMEJPW KNGKJSABHIFDTPQZRHQJTKWLWAIWVFQKJBABUEGJ ADVHTXHQDVSKNRGXTWHNZFJZOMGDOSEFTROIGNRJ ZGXKFVLEFOIISQXQZMUKGIGWPNGNKWAQSHIKNPMS PUPYUUNTAYJLIEFDTNZGTFDZWURDOZROXUFZTLLW UVGNQOTLKDMNYCQUHANOGBANBWMFNBKOTXMZQTOL KGLPCSKWIDRJFOCRKZTXBYVNGYLIQNBMYLSDVKWY NVUILSKHGDLDSTVTJCFYGFAEYMCCQXUPORUCYUOT AZUARTIDDZCYTUXLXGBBFVQTKSNXJJDPRZGPZTID AQKEHNUZAGJHJMGICWQDULOZBDUWQJKVIGRLFWLI OPDMUIKDBRPLBNKJGQZEBCHKGVWKORBKTOEEQGMG ASWXBBDSAJFYEDMUSNPYLWOJHGYZDZQSTAEUKNGO LHPLCBSGRXCDVXRMWDYVQEPUZWEBHWBTBEZGZEND HYYJACMQPEHLDLQXYMALKHVHHRDHNXLSKDDFRAHW UPMENJBWQJRBZKRBYWTAJRAKHUEEWDETLRJZUXTX ONKEQVSPWHLASMDNURBQ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DUIZWUZJHWCVFLQLWLFBPDVKQCGHIVOWPTROADGM QGPQMTPXEZFMAPZEROBMDGUXYLOSBYXXNYBGGZEK CKDBSFRBBIYWTBMARAJEMNEHBRHYMXJKDIFBYUOE DIDNBRORVBREBFFWIRRJPKUYBPXZKJAJGVPBMHLV SUKCOLTTUNOCSXLESQPZNKXTBCCSMREZSJOFBYYC XTNFBLWSUNFWCBHPGYNZPWPZTMQKMGAUZVSMRTKL XMRQQUQWFANCPKVSCRLCXRNAIBLRDBXYLDVWBOAX EWFAHSKXKDDTUCTRDWJMHYKUGTOJNCNDIXWSRHAA OZQREZFEPGWDORPKHRGUBUWFMIKJMDCDRKODQYJO DVHKCNYDPAEOIIXIBTEAELAHKZBAHXGCLRKKQKLN PASPLHXLYPMFFHIUPOYJRKVZJSNYGWDBEWLESFVU XSREYQXWFCQBZIYWKZBWVXTEQLRBLZUDUFQXSWPO OYZPVSRGTYIPNKEOSDHARAOMWMWKYYZMDWQQARIY JBDSOAQNZOAVFEEQBOCATJREHNJNFBMVJSXTPRPU TTDZUQEJPPSHYJKBKBHMRQZSQFMHKELZCFQSCUUE JBKYSAQVXFLUFYSQEATYEOSGYRIMYWNPVUQBJUKE WTDQXXQSNDGNLQHSLTLHOYJDJVBCKVTCORVAZYLV KXJFRWSKDHRGCKGGKSEQKCMGFBKHCWTMAYYALDEB WOIRGJTOPPYBETEZXYDWZSMOSAGJQAUHYMCLQOUY HFYLYRYDGAXLJBDCSZBHBRFGCEZDRNIPBCUTVAPK TFRSATCRKMHCWZMXFMMHJMRSVKZTWRPFTPYRPSYB XARHZUMHVCOJKFJLOTGSVFGDGFXUVUBTVSRTELCN QCJUTEWYNAENSYPUNOTICTOFTQKKRAEDPGCAKRLO JECTBYEOWWYFGMTOVRYGTZCDRMDVNFVUWEHGAEME HGZOCWALMQTYKEWMHUAQSOVCCIRAYTXRRVQFECNU DWNFAYPTIMDSGJDUWAMKUAGFJUEBICXPJPPPVGKO SQYZHURUBULDTTQOCBIAFVAQWMJLYVULOSPNJXTH EHLTQKCATLMVIUBCHBIKTIVRFMBMCGUNQYUGCSXU PQYRGRINODCJMAVKJLOPPXIVMOFWKOSBXDKHKSZT VZVOQDQYBTZSGFMBLQFMXTBEHHJVXVSXGPUCZHKQ PUFQCEBGEOOFGEXOCCVMHDXQFQHADFBHCPRPDLDF TGZMLLBRSSTJKNUJSSVVFRHDGPDKWIFTVONUAWON RMIZVQAXCZKWAHKDVIZUFULLLFOJXMYGXVQGJLHA XOPLKUJNDOLGQAHJQARAENHQOLVARGKKKHCXCTVO RNYHEMQEGQZIWDSNHNEPMQJMRUHTPQXVUUZIMTEH BRARCGWDKZKZLDQAXPQTOLQJQAQPJRBMPTKPAGQE ASIQKETMHNOIUKKVTWRMTPVFATGFNZKEHHTCVOZR IMXXUKYIZDMOMQUNMYLWKHMGVMCYGIBJWPBUMNUQ FXGEYWVMRYXUMEIKFXAKUIATEVKMQYGRYOTTKOAN OZOFIJBZQDJZMDCQUWGODTIZNSWARMGFGOMWEYOS YTMIUPCGLQDIHCBHNSDYARNWUQODNIGIQVKAXGUI NAOSSOLBXGCESPJDKTCJKDWRGSHNVYUWRGIRLUYT DMNOMJLXAQXAKRYGORLRVOSUTPQJPAAIBPRXJVKK DELRJOHOXSFFSUGTPKWGHCJYVWNAAXHRUDXTYREX QKYCWMZGKUZGRHGNMXEBFCNAKIXGDLSSFIOQDIXA QVUJMZISJHNCNMYUCSXUCRWGXFCUYJVIKXRSFBLQ OMTKWFJZLILVOZTRXMCLIPXERJNFDEVBXPTJVRMC GPUVWPDRAJJMIEFEQVDK
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PGJXMAPMWZWEVGSGQYSUMHDMVHXSDPHERCQTNZAR DIWORWDJXHCQPAAPFFHFBZVMIREPYRNLOAWCWNFB SFLRERCMXHDOUTNXJQODSTBCPRTIRRCGKEMDHHFV XNFHDPHIWMHKLFDPVDJODDLHPBELTFFUVBWEICEF OWDRWAYJPKGKOYOMXDQXNLPCEZUITKZEPYRVDEMT BMRAMPMJTVURUAKGEAIBHGAGIIGDOVWZOWOMHGJB QUYWULMDIHSATPEHVZVRHAMWAOFNVPIEEGXEGCOB UKQHMFAUOCZUOMMBWJSLTAFDYNGSSOQCSGGHCFSP NCAAQHOLCUTSQVCYSMUMTUQXNJKRPUGBTNRYHYLT CEEHURUCZWOWSLEKUXHDEPWYFECPCSYZORHGRLBO JQEHVOTASQLMDSZRHLWVWUKENNYYCRTOZOKJQMNU CCPAOQLCVUIWGPOJDSOXRYQYDSFFUNBEOBAHDFYR NITXZVOUGQEYXHSYXCLCWHLGUQLEKSAQBWNVJEZV VZKPBYAGMCXRONRBIYXYIAEYLDJLBXRGBRVWXFMG SDSXTIZPCBHGMAQWHJFXDASLZBNTGRFHAQXXHJOO RAYZFHGNEFMMMQAHSMRXHNKXCEQTMPYTMLOFBDTE VVPEPTVQHPRKDVZFHPEHVLLEAKZAVKJINEJVRNUP XYICGWNORPIKKCBRNSTEYZTQBHWMYDPUGLDQWTKD QMTPJYVDREJELYEZNYGMBNYZHHOQXZQJEHIRVSSN JJXYBRAFMGIYAVTHNIFSSZNQMVMWHMSDWEVBMOAV LSNPKIWIBRIFYPOXDAFKADAEKZASRMMFUHEGKJRI DQYYIYMAKJMWAHNSZKOKQNVWNNOSLWTJKTJCWAXS XIZERZAYNQRUAGPTUBTPUDGBVHVJDQURBYSHFKWI YWCEZSPJJVKEKZXLUCSBYUOYBYRPXNHASUNGOYOL KIIFUCFBLKWTZDFBUBRRPTGJWMTBEPIFJNTJCBYD RQALQKCCEWZUSYJETLFQFUVOHMARRJXKRRRFJPFO RDVWCMYMTQPENWPSSTNOXAWHBLSZOHJVGVKGZQHX MNMJXCKUBYIMJRASXIKUOORSLNEDNFEDHVNEFJCX PMDCYTFLBVSIQWHIQKYYAFWJJBJGGUXQJIGPQTJS SXPAWCEZDURLMUFUPKULGWEXIGRUXMLRISIJKJBD QXHHMPUXCJYHHEIPBDVORHTWMEKMJCXCFZKKRFLS QSQGHRTQSKAZBROWNCFPZYCXGVQZGHLDMTBLQYUX WIPEQWUTILXBKUZWGDOJZPPVOOLOMIGMWIPAXJKU XUFPDZYOPOIQPYARQNRUFHZYUTDBBOEDCEFYLXFA WVOBVKVDPDYEUATZXZPESBLCTPBWLYXVSASEQETV OJDLZBKQOYIMFPWZZNASQQRBPZMPSKKZSJHALKNT NTCQPIOMSXLUENPPTVQOJHEDIZYAMMSYCVWRHICI IDKLWFELWRKCKATIBODKQAEZCBGJKXXPBGZAJUHT ZSFDCPLMPLCOSXNTCAJJEFVMBMJZRFMQKWALREKF GSLHAPIOFKEXHBJNMCNHBWCQMPGXNGRJZEZWQJUD ISFQHFNVNMGHTXLAVZLKLNBURAZOOTYFANPOZRCV ETRGOEPPDWCXMAWWNDHESZHTTCTTPSELQZFELHPJ KZEQALCUNRRZKIUNQOSHNJOYZCERDUMWGMAFURHS CLSOVIUHHNYTCLFIVSPAEFQUOHCKRWDQEFKQNTKQ UWDWEFSLIWSLISGUNVSVHZZKTAICCYYTHBPZXMHF GTRXYLENHLEMGJEBMXUFWWPOYCNJFJQQSFZOQOMB UZRTEMDGFIGQPBUYVJHWTASEYCWLPXUMKGHTSNLZ FQNPOUCPQMIPPOJIYWZG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NHFUODNQYYFOTWYHBVRBBXGIYBXFKOAMJEAXJTBR MZGOVUDQGGQOPYGRDKVFMYHUJCJUFHFIFEKMUHYP PGUWPWDQNRQEWIXIQNWOIZIROSDKIVEANFHWXIFY QQXUNBNHCCRDRKVYVZYQCYIAOLCFMNXDTCYWXFBA KYSXYMSDUDKQADSFFEWTNWZDCEKGQVDASPOYQAFE ZACIGWIUEUYONNINFGJIZCMPUIRXEKCJLBYLNCFE BULEPOPMEYPYYWDMZFWMBSIQROLQKEMRTHTABFMJ LVSZZFVXEOZLBDLSFPJLOCHVBVBDEDDMVQRIRKHF HJRNDBAJUOVNCZEPBGOGKBCJHTCVHLRVLJLQFJLK IZOZVDQAFGAJWSIMYIUWMCPUZBAVHNJTVNWKQOJL YQKFHNGHCAFTMKMVHNEKRFCGBYEWUTAWQMTNIEWL EFXJLPQRPVZXOXQWHMIYUTUMFNVMLWMWGWXZZQYA ICBGPDCCFRMUFSSNGJVYIQWKVJSLENEJAQGZNXVP IGWAVEFCATFMECWZYVQQGJADACCTOGMMEKJEITAG SHBQMILIUJVQNCFINILHPYLLGOTORPCSZZWKEWHG BGGYOKNSMVQNDNTRZZXVNLWCJZGLPIOWFHVJOYJO LZSDBZPWHNDPSJZOZSOJQFTYFBJQUNKANGNSVQYD NBFJPRKYCHZTFNLFUXSSMIQSBTDDAQWLVDOBWYJS ULKZMLJXKQCRHXDBSCDDGRUYTZENPSMHHQCCWMKQ FHEDUKAVCKMXDXGDAKZMXLTXHJTSHOUHVTAYXVZI GFBVTEEFQYYUKOFBFARRUCIGCMFXOVVLMAEYJHVQ ORRNWGPSMNQIGZMAVWRVFRDVBMPHQIYVSISSXFIP VXJPLBTPVVRVDULVGRRDWXQVEDCFPDDJKUPZSYCF ISSBTSUKFIMRQUVTSIMWNNMWGQCKUAVGEUYAAFWF BGCNPCKODBCFTLPDXFSYSVLWESDKKOYHGAMSPINJ HAWAIZFEMFNLHVIXRYIOHRPXYVVWVUGRZCJPRQKT IZJDQRRUQZBGXFIGWJJNLNPFASMJUPGBISSXOIDM KNCVAIUFUSXSJRYPETRHVPULQIMLRGWKXETALNSZ CLSPSQFZETUCEKBFMPTBVDTHSPDISDTYFINHVBUN TLQTKRBNNIMMDQOKPMTSGVPNUVQXFNPZOFZMGRWS UYSNRFZCSUQMRZXRPKVVKJHBZXCLUAMMNKPEFSQK XAZJXGFEYPYBDVEFYEPSQSZVQALBNZZISLOQMILT NPSNXAOTUYWXDNFSOGFQBSUAZZYSCWUUVCGAVAGW VLMFAAEMVKJRBDPNTLWMRCTRDTUYQQHKYHVNUFXB SEUKZXZHHISDMGCHVVKHUSUAWMBQKAEGPWCXNAFV ALGMLBHPWSUGPUEOVKSYXRYAONGLAUJXIFTMBGNR DCBRCKFKLTAJTLXUGRAAZZLENIXOITIYFHPEHCAA MVPCXAUMYOQEYZEKQKZLJDTJQJAAHFEKZCNQDMIV EUNZBXTYZXZIRVNHFQABJWZUVKJJVWEWQNMXCFJK VNSVIZNUYHIZLWJVXSQDGARMGUURXPXYKHQIAGBL QSUXPPULYHZUGBUIITAWWWUNLQPSHOGTVIOADHIA DRLVNWMYUROBOQSBMVGJPCVYBSVRRQAYBKZTQVTE BHUZNESEJRNGJQBIDBYUCXSGDPHRQRSLTCJNFZFI BWFFVBPFTHKCOELPDXMTYIMWBXDZLLJZTBDZIFKT BXMVBBXBYQWQLLFLLOMNTURQYGXOFTTTAFSYFQVR WDJGVMBLCSEOGHKQNLTHYRIEFRPTLQOYJKFPHUAY USZIRXHVUKGKZVLCIHITXEKJHWQKHMZVOJIWVEFX WBCMVMOICDSMAZZDELFG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      UNYGYURIGZXMHKPGDNHOXXFAZEZHLRARCOCNQMQT HFLSRXLSTGUZQJMUGXNPVUBHEOWWVGSLXVHQIRVC QBNVCYQFPLJGESPKBANHCHWJSCVRGILZQUPBKZUP BHGUUMUYSBIFWDYGFNISXLHFFCYGZPZRMRBBLHST OVOWRTLAQAXZURJUYGSTLORWHKNFNQSTLBKKGKDV AMRDVUVCMYZULIZIYDQNMEDQBXJCPQMVPDKIMFOZ IAHEPSFAHKSEXZQXSVYFCJZBAVPTAWFBAGLIVVGK LMGGAHBDHMNYTPLQPIGCPKHCOFHROSQTFHZYWPDU OYPKTRVJHUUSNRWPOCATKHBDEXCYANEQXMTONHTQ BKTOXUEUCUZVOCQHSFZFYYIRLHVENGWEBBWLNOBQ IPSZJQZCVZBCDYWUFULOQLBOEMNKYKHWNZUUYVON TMHSDVIRPVOQDBURGPHWEWOHUXMGSMKRTJMSNBVB IKSDUYPNCUSLRVYKYXMDGNBEMOHWDUCJFZIZJEIK ICCXECTXYUNYZSOQJYCJNOFYYLOKXLFGOVLLKUQP FNALFBURFYYMNJGZEFHRRZHPKMFTBMBQKFNXEEVS CNJRGRNWAYTGLSGBLYXYIIWJNEGCGKPRSIPWYCXK HQJHCSDLVETGDJIHIRALJNLLDDGNMKBHRQXGHJNS NDLLKKWVQLVELQLQIKMNCZNLWTIEHYAHKGMALQHR QTGBNDELLETLYXDUGMMHUKKYPDSAQOQQYJQWFFLU DWSESKXYFUTWGNNPUGPDAXVORSLNVKNAGJIRDTAN MIUGBBBKJVEMLYTABFPTGAYBVUYSPTRWLBAFAYOI GELGEGVXTZTKTXXQTGNOAQVJZFUVROQLWTZNZKJZ KVXAAGDWMLMMHMMSMIIVKUUUHKCLYSBDKPUANMRN QTHFEETENJGETCJMVRQJURKZWTXQITBFZLZNJSZV SMZVQDVKSGRSMXCUDKJAIMFBUDNBWDXAXAUZWHOS UOOHLNCMDJGGPNKCICSYJOELYCBSRBGILBXSUXYB NBGBXQLTWQPZQDXHJACNRVBEBENBDRRGEJQBFLQA ODGBAILTPVMAHHUXVBKLYSMQXFTWOQHFMIRODAZY PTEZIDZWSEFRURKLPKQUGCCAOEGNXSWERDWYWPIO UMICOLFLOPQSKCRIDQUUTXBOEILUFNLTQJZOVLLE FDCCLYKUPXSIOIJHBFAMMRMBNFDALFEASGFMPGMZ DOKSAGFBQENAQRUXEJHCTBEFRWIBYXMLSMXKJNTU ELPXDMXTVLTUZPYYXOAVJCTGLFJMNAHDXNQKEBPQ WXLGKFXFNSYLZYBRAXGLCASPJOESCRGXXAXBQSMX UVTXSJMXXJELOPOWDPVEKATXFZATPUNHZPJNKQBR RBQUCFHFAERCCUTGXFUZXSLXZFQKFUJCHXMDSZHM AWDMGWDERADOKVJWJNPQKAVSHBWYCPFWHQERDMLZ CBBYPQNMNWNYEZWQGZGYWCGGFTIJJYASOQKPCWNL WGPRTTXBFSUFNOAYVSNYKOZTSFGPTDTIGRWGZIGR DYXORIFKZAOIFMRICPVNXEIXYIBSCZEWWGGUNVBA EVYMUXFOJUCFSCERVEXRSQBHNOYDXFBIJSPYMRNU UNOAVWWEKCAQAICWHJGWEOHVZXNQQNKHANEPXZNJ CSJTZWIZWVQJLEBVDZELYLOKBNYBDUZPGGIRPEKY FECJLJBGVBVEVEREWCNDZANYEKCYGAQBBQOLOTOL WXIYUUXSQAHZCYDNVTGIDJKTVMNRYRJMRRTDNIXR ILKGFIHJPLTDOOXBCECOMMDBCJQPHPDDPQUAXMOK HEGTBXWUDBDTSSRBMUAPDBVPTVSQHNFCEOFGMSXR BEGIYRLBJPUUYNDLJCXJ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WRBFRGZMZRNKWTZZIVBTQLFDVLDDTZZUFGFUKDSO DHITJRBANXKEJVTYFMVWTTMQPKTSGNSYIVCSFPPD UVXHHEXEPZGJEKJWCYZWNPBRHECIKECJIKDDVXFL UAXYHNWSTLKGQFVUPYUDDZYESDIAVUHSOSIGEVUM NTICRBFGFJURGGHFXWQTKRDEPJLNUBHUNVJZNCNJ FUNPNVNCPATRUDGPSITXOWNRDZNHDQZKOPOTIREO EJDJMFZHQLRRXEFBEQWKRFUFMIJBIBDQYQTQKXTI WMUKEWSSOSILSESBMAQEOPOJXNQJIRPPEACAOCOZ NGCBOYMECCGXGBBWQYTZEAPCYXVVRCSCSKPPXLTQ NIFTDHXMZLOTUUFNHMABNXNMCPEOUZKKHICJYESS KAKGDMYUAVBLCPPJPZBDUMIJDCQWMJLOORPLEJMR XCAYVGAXRQDEMEEKRLIRMOEKNBGMWNPTFADALNKO NFAULQQTBCKYFLZJTVJXQOZBJKRXWGHEZEEAPYHZ YVYMVPNLTIOOYAQHJKYYDJMAKVJCZWGEVYGMKOKW KXKPMSULPTOTKKZIBTRYRXEJXNPGNDDDCZPQJCQR MHEHJOWUWOHQIVGDWSUJCMLCKBHOHSMLIQUQMXSZ HWOFWDANMTHKKNLSVZHAANBMSYYOHLYLJOAYNVWC YJJZWSWWSPJMGSWSQGFTGEYBXEQXLVNDWFHMKPOR ZFUAKUVBCAACZBHYELDBAZXBPBORWISLDVUFBJAM LMTABRPDFSPVMPYPFYNWSJXTECMYGCFZWJCTJLZO AJMJKGNONLVQUPJRJZMGHTTVTTAQEMVBUKGPFSFO XEJXSADVOJRYVBSXFVDVDSSVNNVXGGZYJFAAAZFP EIBEXFNIUCKGXNEJSLVBIGDOZANPACVDYLGZVUII EXMVEPZUVVOIAYDYTEJICLZQGYCSVQQFWRKXEXQJ QRWDTLQUFQYQZGWAAFCICYWDUZUABLPQIALJOQZU BRUUTWATYYNIIKCOCAEDBHIDAVGDODKWFBPAGPOX MNEEOECONZSSGMGFZXAIDFTCMHFZBRZYAQVAHDMC FHSPFDIRMSOALALBQIFZBVTQNFXBRYJODUWEFIVE MWNIQZASOHTUOFWPUHFSGNEVSEDEWYFKPOJJDWPD IZCJVQPICJQKFTDQFOIIWTWKUYKNEEGJKUXKUMIW GEPECWSPWJRPCFKLTEAXMGITMZLIXZXIQUTDCWCB BTFJTPCAINVBATFHITTNWOOFYENOTSKQYDUOVDHN GQLTYZGFMABVLJGJYSFWOYILNBFZHYMNGHDNZXLE DTEEMBREHHSIJBOERAERITSOBWLDAYQDOLCLMQTL DLETOQATLPUFRCZOADWUUOLYSJSYAULMWILHLBBO SRPNJIWMZBRWEBVIKMCETSLFLGLRUHJFZSBXRREI FWYUBCXYYHHCSJBISOUCFMGLGGNHZAZWWEPSOOVQ VBYAVKCKHUTJUQOWYSHFIOEVRBTNTARGZFNDTTVT GNLRFNWGXBWMNZDSNFFJYTTTMWDRTYBCSHNWNRUP EJPFGTBNIBGCKBKNXHORFSIJCLLHFWTBTPTKMGAQ OHVKNZHIGFENMMYRQMZNOSPYTXAMFTKUXFQUAVZV KLRNXZGDZWBUJFLQHDUWPAOOGJHMXXBPHTEYRRAI RSCRYRSIYQNOGXTIRYDTZKVLPEMVEOXJGZQQCHKA AZFDAWXYFKIYGGFDYHZBPSJDAMIUBAOSVUQHMDCM FMGTYCVBSZKUDWJSMOKXYCMDKJCCXQKRULBIQFKC EOFAOHPTLELSJTHBPZBMLUSISWMIOGCSOYOQQBKL NTXAIWTQEQJBFSVDUDATOMJVOWUHPVPJDYYVJGOH CISNGSWBTWFCTNETQPZS
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TSNVKZENWYGOKIHSUCWUTKOEBNRDFKVJFZZDCGZF QQMQMLHXWCGYLIRTZWMTIWOKEFWZHVAMBSMKVOWB TXVKJPCUNYPMAQKFYNWPFLWXAPWYQJUYNSQPLEJI IASTKTOXIXYZSOKEYTQRDSXRLIYKLVLEDTHSRFVV VSABFRBGIKYLRTQWKGDCFYIQVBKELHCFJAUZVCJD NLZWUTFPBPUZJKMWKLAURPDAZHXKSBRKLWBRQPAT RLTKOBYXTYBDMDMACSLIDQPTMOQCAEGXAFOETZMV PMXYULZZYDZCUDMKQOJNRTODNVJNDJIWANOTJWJD WUWYOVOAJWCWGYTYUBVTSHTRYSONOSHSXMURBLNW WFLEEUHNWBTEMNEMTIXQXHGWZMODJNCLRQULHOWU BUKYIMSNGMYIGYMPPYMGTVTMBKSKGSJDEUQXYZLM QQQWOOYNVXXGVBTHYJKELBJECKZPZJEOKTHZYWXY PPIASLAFLHBIWIFBQKOJPBSSVTFVJYYSEIYWBSEX DDWKVXDKWPWMHLWUNMHKXCGHWNGBIZKJGLWNDGRZ IXEAYQOLWZKZWDCABSOMLZMVXRKYBRNZPQFEFBFG NQYKBRZPEBSIXOVWSGWRBOEQJCFIPPVJWQYMIFPW GDCARMNKBJJTZTQGXJUESJMMQXTRTBQZVONDJRQS CUXDVYFXYYIUXYHHWLQAUEILMPJBYNGGKDGYMATW SUKBOPFACYFVRRMTIOSNEYSYXHMHFNLJOLZWOWYH KKWWJFFUOPOOZJFTOGUDADDJMYKRZQPPXCLYYZRT OPFXDFYISLELKHOPRJMVNOIDOJJIAAPWOVOQBAVI JGOXDPEXZETHZGAJAHWJBFOFLMPHWFZXKCYBLKPN RJOXHZTCIPZDMXRMCRVBQZYWUKKSUCAPOMIXKDXT LQNIPJZYSNDCISAKIEOEJJCIPZMBXPJCUKSQDKRA FHLXHCVLHPYZUXCVYDBPIAICVRTNKGCRCFXLFDTK DDHREZKNUDYLUEIKQXNAUZQLTUNVZZYNQZKZUBPP ENKVBPMWQPJAVFSSHAUFSXNXECVCUKHSIXMQSXAF HUGNEADOWKBMGEBTAERDUGNHGGFYDNBOOOKVYFWD CZMVINBYEJUEBIVWCITARHDYTJGHQRHHQTGYIQAU TWKNXFTGSMKBBOPILFHNVEVFDLCZRBFYCMHRSPUV QGSGMDHTEFLXWRHXYIJLLMSFKLAWBIDGYAQEQRSU JZBYZYYMBIPBYYOOLOJWELHYXOKUARIHLKZVEOEM WCMEWTXIFLGPEMKEUHAJRJSUVOXCXMXVLNMAMUEI ITHUQIEJSHXSOJLHCHBNJNRLOILRRPQOIBYMQCEC DCXEKLHRWUDLUCMRQTNDEYAZHKXPAZRYZKDOOCPC VVEWOUTHYFVHBRVFEGFTAEZKBKWZOYAWCNHMNMMD KFGMULRUZKHDXWOGCPBSRGOMANVGNVKVEJWHHYAT EMCPWXWIHCCGBKAVAVHIXERQXFQBXBICCPRMPFEU MQDCDHIAXZJLEGVSQGJIQQKQZVEAOLVQNJEPUFYK WJTNRYHYZPCHHKTRURITHUTMBAXCURKDWUDSJVCV KKPMMBPNTXRMKUNRRLDCJIUICCFLYIASVTOJGUVL MIPLWQLZUGAHLNFRCEXNHWDGYMGQVQTNJAKZJENQ NHWMLIJMBZIBDGPBXDOOEBDTMKVTUHAAYBFTAZQW BBZVXLVLHFLVAQEWQOWOUSCVYJXFVHWNRULCRKMK SLACBKPCSTMXYDLXAFWNPOWEJWNVOMAGNBNENSSE YXBHUHCKDSWDLXPZPSNQGNVXIOVKFJZQWIECCFXM ADWGQOOZAGYUUQPPRHISXUZPJLRHRZGECWQPRUTT CKXNUTNXUYTEGVXRZUEY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QTUMYFKZIGJJURFVEETSNDRAPHUMDPKVFDKWKMRS UHWXNUPHOMZFSOSFNFRULZJKPTZNXTHYTEILVJIK DVKISHQWYLDYWEYJGWSUCLXRHXSONUTFCYNQHZBR KOJRDGTCYPAIWJAGPSJVCKCVLMYNQJVASCALFHUJ INXBHQTVDWPRCPUOVPPTHVDCHEIBCSRQQHUQIBZQ IJZMQDBWPOKOQXPKSJRXCUBOEGABVIWEDCCAUCJQ DFDVAFVVIQMGCHZBFSFUUWSPOENIZWQGXQUVSHHS QZCGHWBYBMELXLPPPHGXJLLCYQYZNVKJEZSQKCQM APFFACGQVIXVYXUXEQQQHREMEIUOETEIRKUCZBYN AOJOHPWLAQSQCHQJFRDPIWEZRCRSOGENWMVRAKZB PLGILCTVZSLLYETWNAZTAJGEHEVEYAIAOEQPMNAJ QBCOEYSHKFMLGBLXAZBJHRQEOBUWNEOYITADZFPO EVWXCZSYNXOSCQIWTOZNNTQGURYBHZINGFUQXJNN GSYWNXAUTVYOKAICLVWATOUMSHWISODNQQNRRWCP INTHLUEGJSLMRCOTRWVGWYOKOBXGDMVJIRWLQYDU XWXYBFFHDIIHSLBRZSUQSFGKCTRIRIXZKDXKBWFT WUSPNVUCQWRDCAWEQCHJHSDVWFRONXNVEFRXCBWK HIWGGDORKDUEPTHEZVQORUCOGKNPSZULQAUTCCAT VJBXXYNDIDSCAVCVJWVRRBULLMZTNKAREPPOWNOT ZDOWYNFHTKAEZURFKCZOBYWISHRZZCEYBYBXHWII CHYPJMADASRNHPRYGNSGUNACAYAUZOGLZWHFBEPS XTKGHQAVZZHFNXACLQVBIRMMHRXOIUMKFTZMJUEI RKSPFMGKSGBPKUIINFZQKGIFJBWWSSNEAYHSAWDF QVFBHSEDROJQWDHDGPLFUHBGSDYJSGCYUDWJOEUC QSEOJOPXECLQNJBWCHGEFWRNDWAXMOMOBWBLUGJD EJFZSVDKFXVDYLWETSPDFCQWWNVVMDKPBUXNPXDC DDCFAZAGVPMPTLUVHJNBURQQBPUFBYWUWAILQPJZ TATVZHMOGIRXPCUZNDMLMUGJSGMWNYGETMOAGTRF JYOEABRTDBHVLEJHLEAIAJSPJGIIUCKACZJIPMPQ LNWSTTMDCPVXTISHMTQFTTMPYSXNUVDNVUQASZTO TZZOUQHRFPNFGHXEJTPASJFFTXROEBDGARGCQPZQ LVAJPBPDBRSNCOAZMZRBSENCVEJZCBULNFVZCYDF HVORFLDQUAJMZIXTBNFAWFMZYJTYESMDAPCQWQOR TXIUDBHRHCJTJYDGIKNDULGCXJMOLUBTUSSKYZRB NVZRFRFHHYPBFKMJCCBPIZAKTXAKVOPTWMPEDBPK HMTLOZCDETFAOBCQBGMILNWYDRNVCSQBPHJJRNTC FAXJSLPQPTDFYHGHRGNLJSWTDMRNGAPKJKZWPDFO QPSVLYXNSSSZKRZKJOKCKKQBADCZTADDVPHZEUFO OMZGGTRFFOMTAHATTTXQPTJSUPJXNKENSSTZUEEA FQLOFQERIQWSHQPBKSSUJDZZCWCVWVDGNPLGOZXE MHCZDVTZXIKWIHWJYPYKVJFNGNBKWJWMXTEPBIIM BUSRXVRLEFOJBUJDGTMUXQMZKUETQYFBIQFSWIIT RXQEHTQYXSFBDTJVMIHHWKJWNEZBAJQMTPDPNZLD BIPQBJNHJLSLNKOKVSSHVULUHYSCLAYZGHRQJQXL YRRPXARLAZDWOTCMGXLOXDAHVAJMEUUFBXLXJAND DDMWJRGIBQJVHVWJAFCQUMJLPNSYUQALMTBBQDSD QILQWJHZCQUOMFSYFXZBCCTOFCUBXUFPMCFPAFMG ULJSMBJGGXPVLRQACMXE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HKODWQWSQBMBLPADHIFFVJARDFYABUSYGYCYGLZW EFJEUALRYGJECBWWXLBFJCDZEHZYKFHQPYBIHYFW ZYJQYILFTCIGNCXRJXQDCFMNRUITRDHGNPWNZNZZ JTSBTNBOTKCSYBDJUBFEWJYKGFRXOHWSGLYBOOQX PADETRHGFCRNIOIWTGDTMLIBPHNESDWZDOHEEIVH BNAOXISVZQZMAKHVNPLWWNAWPXRSBLXDHBAAIOBF YKSYNQYNXKTASFZXVLTXXRBGOVLMEIPPPLJAMYWV USNLSCYHCSPLFMRUPRHRZUOKDTWSIRQUPKWQODEW XOJTIPUGDBTVLEPCQKCLIQUOACJTNTHDMKZJEEHH BFRSMLDNBHNFMEBCQUUSAALFRVDWGDSBSMJOANEO LYECPBJUODWIPKZBDDFEWDAGOOQKOOEVXAHRWAEH NAVPGTXBASLUCQNAGMMWRTQACIXLEGFPWUGWOGYN DQIYAWKLFJCDZJESGMLFJCJOWFSPBDRJQOLXXKAU QYNAKAESTPDDWLWXWGPXIROFJEKFCDQXLAEBTENW AIPZUEYIQPWHVUITNTAQFDXKMKBBHMTLOLUELRSK ITKALVKBXHMTXYBZRZIAWPDRITDZCNDIYTQENVLV QRFUPQRTPXNKFUCJTYAVWMTTUFDTDKTARFOTXLLN TILOMRCZDXCWODJPKRPXUVUBYBCIISQLYVNSIZBK NQGQVWTXGQINSVAQUTUQGNMFRVWGTQKRNJJBRDMB MKNYWEQSOWEQZONPNCKKMDRIKHPFRQPDSQHBUECA OMQPKVEZGBTTWCXLGAYSKCRIKIEDZNAQHAAPCAVN UFBOMOJRDOGNGXYUVYHOUSYJOVEMRBSKTRJCFCKS XPTCICNTHAMRLTLRWRLALSUKFKGJBCQGPNKXXRAF TJXXTCMYRWKWRKAPCSBUTMVMEHDCUUPEWZJPUSEB YZPWEJICSRPZPLFPXPWZYRPGZAEBNVCPMMBJFBZV XVIWUVSBQNVYFXADXYCAGJATWTJWOTLMUYJICZWJ IVRNFFIERIXGTPYCTZEQTGZVNSSFOIHNCBMSWDUA FQJMQUEUSBHBZIOANOUXZCGGAYOVRANUTJOCXLVB CQDIQNYLIYUBOEDUXQDAUJPUXQLQVVTCAHRZFWVR NEDUSVQFQCWZGCNXLWBKOBLFYXLUBHBXHIYRESUU QOXHKLIRGWXEAXWAFSPKQDVLTKIYLRGZLQLDXPJU ELPCTZVVOONTCDKERRMYILYTGMVWLGGFEYAYOYEC TBUZLQLOBTURVDKPCDDCSKPQOEGFKQKRJLMOLWXC ZMGRDQWBKTAZOGCUTILFIRJTXDHRQBPTJWLGXTLS HJIFXTHLSDKMHPZWFDFCVSCLIFIWZHLSEMFSHXJX TABURGAVUNKNRYJISNGOUHPEEYQBTACNJRRWJDLD KLUTMIZLZTMSJMBJXBMXZWNHPKPXORPRRGXBJNEI YJDCBQPXFZDCQOZNBIQPTMZIVSXFIOIEXWIVVCVU TDLUHPLUTHWPLVPANIKCAFQPTBCVDETJEADUNUOI WHMTROJVYPMDSPBHLWMORSDLRYGEWDXETEKNWCBB MEIBGBXUZEANXLYXWKYOGEZFSAPHYLISNZPTNTPW BQCSUZCNOTQDJHHFZNFXMSHDJTMWWRNWVDIBTHSI TZGZKRRXBCSNOQFXKJNBHHGQIUZUOGZOFFIOEFYD PBLELGMQSKGKTRGPWNIRRIKDVDHXXEFNPMNPDMBW STUHDSIDRIAUKSEVDZRDXWUQWPIMFPBCNNVEQPAH JGXKTIWBFLCWVVMRICXFRPKARNAYMOKWZKOTDXMR NVPCYCFAWBORBIJOXUFYCLQERWNKBLWOXTGHNEDF WYYLYARHZVKIMABXTGXS
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      IPQWBYUSGNWDVCOOXZGWORPGPYCBZOKAQQKCCCXI QVNHVBAGWAUDPXLOWQSAIMBRQEVOFDGBBVBBORLF BBENJEVVMMTAABODYAODGEWSNFHWZTJTYXNLOWLS SXAJJLHJYIYOXGYZVBGONMHRNZQSPTRDIZYFMNAO BXSMOELQNMHXKTWGMKZHUVSPJLXZCOUQSYLWBWAE XFMQFKFXNWRNSITUGWZJKFCRABQNNREUNNBUNPBB BNBXFIWOMLNBTDUVYOEGHQVABFLIFNNWLNUCUOZY IJOQCLRDGUETDNELDNKSEXYILTWOHVXWTBWUGLDJ FZGDWLFTAKTBPXYIDAVRSMTNPNTSYCULJZGFTMDL IYJXNORILJXCAESXWUQWEGCUCFYNKDNTSBXDUFPG UVGPGHXDTSBEFSGIYXUAPIPVCKOBHMUHVXGKJEVV LBZMAHOJZGKAVBRMPPMMYDYNFJZERUYQGREAJKVA DGGNOJRFQAHXHLQCENJGCHDZIBXNUQFYHNAPTIUL OVWIZQHUOXLGDSYHCLUHBKELWSVETSZEQWBAFXMM VYJGCLCJIEGWVOHLIKYIYIBEGYBOHPTJDFUWLQGZ AAYGJATITJTCVKUUZVVVJCLQEJFUXDUQTCGAIYPO HKZFQSIYCZGRSRLMFMNXCRZONJOVBBQGSSUPGFUZ AYBZRJWNRYLEGDUORLFQZKKRGYYRMHJUCWDXTIBU GMJAOIVYUNTTTQETWUUYMYWRNZASPPLMXEUQGLPC TCTGECNQBCZIZHZOHFPQHFVOLAKEFGECKCHLOWCS DNEFREKHGRAHUZCHSORWFQDPZPDQYWNNVJYVINOC RSUHUUGSDHDYHYHAFXBXCIJSIUXBBOZMTEYGKMIP RSZZBPSWUEMCBAICHSTKVIOZUYPONVQNAGPFQMGC MLGAKEOSNZISXATKYALAIRNQQRXHEAXSWQSUSLZC FRCRDRGQOPGTXFJURVQJOZBMRHAVVJMJIIGUADPC OGHCGJKDBIGJNYZYAQMOODMJDRQRMCUVEMPJBVBJ LTYPSRNGAOBJNWNAPIRYHATGWLUYBAZIEKLPJGFT KBFOZFUTDABWOWKHZIVUWPYUGUODMUMGQXBBSEGF AECCYHBMAQLFVDGGHNSCAUORSHQESHXIVVPMSKWI YWMVSHHNKUQZALIXEMPADJNNFJAHJOHWLLSVIJLS VELEHFOYZRZMIVUKJNWEIOBFKGGOZMMHAKMCALGC GXFMQRANZDKKSVZJMGLZATOEAHLQBHSIYLJWHXLE SZYSYZPUBZYODWKYCDYGKTCURCPUEZLZTZUXZQND KKADNQWIUXPAVJESOEAYLWLFBGHGVNEGMHSSBQOU HQEEMQJQZCFLIKGNKPPNZASMMSYODOESCXVWEMSE VHLGUNXRIPSWUBQDMWQVVJEGLFKIITAGIWXAZPKQ LJCPPPUVLNDYNQXJEXUYZOMUNIOOKYMTFNDJJNPV PDCEOZTQQFCJVUEXAHYQLBGXWJHACAQTPYQCVSSK FEGDWUURIHQGPFDPKEDVPEIHYJVPZUMEZHJFQQIH HXMHHTVBQACAZKWRUWRGXOVSIXAXBPNOMHTJTRPZ BVTAUQBNFATSHZKSCFGUZKNOZZZYEOJYGSKXYOHL IOTKZXUQWSLVSSHKTMYSZGIPXTAJKWROVIWEEESI TJLMKPWHOSZGPBFYQUSRJOSDTYXKWDMDRBFBNJMP YGYUKRXIZGBXMMAIKOSOJTCPSPPBZVOZPSRDTZQZ WXHXLFNSJQAGLMVLQWMZURPLXQBOMJRJECFFLYHC QEABFDJILLCKHRPLORPODJBQKGWHPTCCAOFQKXSY TJPSGLQKYCMTWKBZWQPAMHPNZADERDRDMFBDKOLX HAXKWJLPTNVHCWFYRIFP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FUTNLWBZBNTRACXWHMMDXMPOAGKWLEZLJCQFWZFH SHNLJCJEXOMPPCJGLVVVOLAMVGDPFWJQDVQGUQBB RFVYMAUQRIRXUVFOSBHSWLBONQHMFJBNBRXHTHYO HCQDUPVSUUYUWQOQEAXYZDQGJXUJBDHHLJGYVYCA FXHCFJPVXNXILOSXXOHYKNIXVYTHMWPDCZVNJIBM ADFIKBNWVIJJKJXVRFMRRRLRJCENCMWFJGXDAMBB VRUXSWOZJJOMKBLSWECHRJINNMSSCXDHIBCOJAUD JTIADDUGCMXRIUHLRLSSIHSFZJGAEHFJKXFTZRAG ANRZECEIJOHGWIGSISNDTDPGDGSWNKZTRXHOEXEX XPNGJANLFERPEYSODHCPVLPPTFQWLPMISPAVKYEW KPWIKVRVGJUOBPOKHVUEZHMONRLKENESSUCVBWRT ZPOEMDUOXVPQHDBXMUBFZZQSIDOPZSMJCGYAUKCG XMHGQOOJSXTGYZBHSLMTFQGKJUPYZGXYDWYJCFDR SCQTWHDCVALJLUCVNDYVFJQCNQBQGFHABYEOHELF QVADYDSKIVBOMHJZKRNUBRZVHLTKIPYWLNXWWJFQ NLUSWFXMEGHHAKVJOJPHLTYFHTZPJYBNGSXZWMES MSKACDFZFSFLHKGXBPVRSYDBXRBXNFEPPTJGNVKC ILTRNGLRGAKODTCADXLVZKDVCTXBUGTTOWXWDBJQ TVLQRYIADSYXPNJYQFVRJZNTWHYTADZHWPCKEBPT TWYGESBVKTRSEFNWHHNANWETKKUBPEOEEYTLWEHX XQGIVFQDXURENDNOJMBTDUALWKFOFNRXCDBVCKGP HOPJCEZHURLLDSQNTLJIHZQDJBSUSZVBRFHKGYSV MSJCLDXKAKMJJXCCVKJVCOHDHGVYEZUOEBLRSHOJ DOZQGZCQNZCKWKEPULEWCKFUSVJKKSQKAGLUAYSP GTBTXPDGQBYGRNJLCOLVDXUZUDUMDQJKBXLUOZHO BIAWRSCRIGYZGMTLRBNNQKBSVFRGJIBZEYEBKNXS GIZCDSBNPPUWOXUJECVKEOQPETOXQDSCQHJZFVIR XFNRROMKSKDFYWYADFCBAEALMZPDQRXRIJOIOVJI VEVPDNTWFKJYWZNARBSMKDMBJOFJXAVZWJWIIRAW VIZWIIMYCIYWEWFOCKPRQRHNAVOZRDJJKPYOQQZS JNUSIGTAPBXGQLXYAAYFBKYXXVHODRDZDQXSXJBO GIQEVRHLNWKRRKDDNKSCWXUUYVUBXOYWTRPHSCRY MDEFNLXMSMXXSDQVZMNDDRXUILCKPENJKJETHDGA GYGZRGIXBEHAFBOLNNRHQDKMADADFUFXCFWNHKDY CBREDWNNJPLMMTWGWAXZJRAHWLRNSEZELHKCXHTF ECYZRDAPFWNZLVXCOZGASEZQYQGUWEAKZICGJLBZ QAHLHJEYRPUKUBJKPZNVQHNJXBJIRKHWNJHLPNJR PJDJBENJJORWBJMWAKTACPTBGBLTBAOJGFMPEGSY UJXAZNQRKQELRXHNURNVZLIVDQGAGLDHGSRWPCQX AJGSPWUXZNQHXUYZMFVSKMLMGTHIQUCGJSNLWXLL RGYIDOWBOETDICYMQWRGJHYLFCVXJOIGELEQXQOY XYIMQGPGVWPMXGNDDIUOVLGHFXNMZGGPKEVWZCIX AOWXCKCEVNNVYKEKZZVERCGSPXDYRCLHEJNHFAYG ZBMZHGSILLHEELVBYWQNPHWUOBAWMGFREQQUUYRR TSUPWKQISOXJGVPHEERNCVITJTCXOJMJTYJPGYJB TDFVKPVSVIXQXRBZBXUGPKELPTSFRTTXIAEEGHPX JXPAXWQNPFSLRYFXBHKBVWIQGYACXCZQWLPAVZDN BQLDHNYTEKNUJTASMEVZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YUJZAZUTTQRSEPPYURBHKIYXOLSJMKXNSGZHORWK SYBASWNTRGNASBLNJARENQJFMKSKEGSUPTLMRMDN HKTPKCAIBYLQNDRRDUVAOZZBWTFAQKVOLHQXASAN DEJEXLFGAAWOJCGNTWJSTIKNNSQLAHSQUSTPZQWJ UJHYIULDCDBNENLDMRYBSVVQHTGXCMCLGTPEFABU AONBPEFTJQDMNAWZEQDJFAYXHGJMNBBGCHPPWDWN VMBIKDOVTITZLOKBGJOWWMISVVIXOORDKFUEYTGB EHTXIZIURCXRAARBQMVNWSTJYATQHSZBYIDRRVBL UFXLEYGWITDSFGIQYZHXKZIDCWJBWFDJVCRFRMXW GQRYEXOLTMQMFYXITJWWHDRGYNNBOWCJISFICRPB ZTLPYTHLKMEGALMNXHIRFKDWMBDCFMFKAFGCKDTC ASCNTBPRSOIEKUFKXRZPLAHSOCHOQVGURDKSBOXU AHWUBGVEOYILNDZAHGIDVFVESNMXZOOJLNNWJFUA RMZCLZSLWFUMTGHZPVSYGKSLXJYVGVNARGKOLEBS DOXGLWANBWUBFAAVWXEGCBPIEWVHBRDNLMRAZBSZ NZJPCXCDDUHLWBIXDDIOLFUWKSJXLKNKKVYZPYFX AIQMIOWFZPRBFBXUPOCSRJDOKRRRNGXOROBJSYQM HRVGVAAJGBLWTIRDZYZAZYGONRPVJAFFKPXJDYLM SVTYDGRTDRPYBUXFIJWJJWSFYPQLEQMZKRFEZGLG HMGCYHGRBTIFOKDLNBZYKQEBRRLXQKMPGRSYBRRU ONFEMSRXJIYELMNAGAWNFWQOEPJRVLAOREODGLGG DACZRYJSOHIOCSXXJETYSPHUMCXIVSRZQBLFBEIL WCWYOJNALWLUPYYBEENJTEZQPKIOAGPXBCJVCRBH IWXLUBLDEGIQSGGJJTLVLPSCZZCVNKXERVZUUNSL LDTJSOWJKTVWVMGIKDAAFXBGNGFGBPOEGZBMUHBN RPQKJITJXAICBBAKYFCLVKSHBGWNYBCBYFUJTPDM KNPCJZPBFYHQZKWZZDDUPBVNSUOFRIYFHOPBWLKN RKVUTCHZZFLMFLGVESIMCNXKIUQRVJUPBVQRYVUV GVXBYNGIHFHSMULBFUTUQXOVFRKGXQOTBGVCKPZN CVFTOYGYWXGJBJPLWUVYRXBAKWCLOEPHTMZYKSHM MJPYZYQIGIQWJPJZGSOKUCQOLDYWGLDZHFHXJDEB JDNVFFJQYSVEXJZXZFHZRVGFVZUIQWNRPLBBNJVK NBUBNUMFBPLGNKSDLKDAGWIARZUDJMXAKXNGELZQ ZMXQVHBESUSPJRTHQGGIXRHFYUIRBGIHRDVORJOW PPWODOOLRLSMSIUVWNFGRECLMRQGKOAEFXNBZCGB DGUNKOSBKYYFQVJRHQAQEWLRPVLAMMMDKJEBMHBR MXYWYRPRSERQMVKUZQYCHJABMUHOIINDKGEUPHFF ZUPFZMJFLFUEHJZTGGHWYMTTWCKVVKJUDOJOVLEI RUCJLENLSEYUPANTYLFCCMUSVWMDSYADFHEIYPKC PWVXPGDOPTZFWTIKTNSLOXGFHZGRDOEPCZTDUBJL TCYSJRTPFEZYWAKXNTYVHXVKQSWZABVXULGIWYHY NBEBPVZNCTFXEQBRKNORXXKCHPEAJMRQHNHSUNSX JMHZBWQYUVQETPGDACGMZNYRVWJMPKSNJLQMICQF HFCNBNSSJGNBGIMWZLFOYJJGATBJTRENUDILSMVB OGCCUSMBDTKELMXYQIDPRADNSFBTRMMFRVXVVDLJ JFLOTQCYEATKMBGXEKQUWPKVEIVXHZRQPZAWGHOX TGFYLLHRQVAJYVMMZGLEAOSXUIQWXCZSNCCKLDKV QOHXXNSRKWXXIZSNXVHH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DTFDEQPIIZNUPAMNSWHYRZHARMDAFSZYKKQXQHWS PCYAJGJTPTUKWWPTYEWTWCQUTBAJAKVFHNQKLPHI NLKJUUDIFTMSLPBHCPIJQHBMTNORDHOHZCCLMCQP DRSOTUXQHVYCGUIYSMDUNXNFTOPFAGGWRLGDDHBL LKNPJTVMMXWRCNUPCNWHJYYGWPTWMYQSBWPQTOKW RQCCLMBHZMXJHHENQYQEHYLYDOQQRWYXJCPJLKYP QGVCCTIJUJQVXCEQPRSDHREOQWETIZDGXDNTOQAR UAOCFJDGIXQLZJNWUZUYIJTSHLUGWGYZPULJXCFY OZBKYEEQVYARPCIZWIKWFFPTLRJGTICBABPOAPEU SZNBXGNDHYKLHGGVVAFEEMRSXBDKSAWTGWUJQEKD KFBAMIYWDINFZBNDOJTJJAOFAOZSCDZDMVIIOMKT OIYZLXKGGBCTFLKEBJJDWHYPLCOQPMPPSCLDOGRY FNJZZPIUKQOJNFLCZREOHHLIGOILYYVRZLMCBWNP LJEIFVTLUMNFTJCNHXWEKYKZHTHGWBSONSLLUUCZ JIOYMQACIUADCCUFOXOSAJXAZEWJGDWFQKMKPLBC EIWZVHUOILNFYQPQUQQPRNTIKPNPIPNDQXVITPMD HBVEPPJDJXDDYYJKSUPVIAZUFGRHUULHFGJRISOV SARRFFWIACGQZRNCAHPNNQQWDUTFMMUKUFCZZTLQ KEIJDFBYBFUBLNIKTKUQTLVQFNAGBYQLHYBJGFQL KGJQNIZAFRNUEEQCWBSTJSHDHUCTPTTBDGQHMARB TTBQCJZEMBZMOYTRLVKJWXGQXUPMGUFNNKKTEHAK ZLLPZDKUVDWBOXGIXGNWPNSXPNUAMUIZVAMVMVHZ GLBULQUOEZGKISIKKYSHJRLXQKWZWBHVZJTHUBUK VYMDMNDEHPNLLZOWJTAJRGEIOCYWBBAGXOZXIAXZ LHBRNKSTNFJATBCWQQCSFIKQISHOJRQPGJFEUNNN LDTKCIQHPKBGKHEEQJXZZVVLCLNPIOQPRIJPGXYQ HMUCTQGFEWEQEIMWMJUOETQBATZQTZELAAVEUOLC HAQOMXBNTRLOLMFXCFIAELDPUPGALLOKFNVJFJRC QETTWFUYKFGNUPJWWWETJOLAUFZADMNAJBTDOVVH CGDMUCLFEPOVCPJMAMPYYFYTWNARGBWNHMFADIDW GMCDWUAQDUTDTNMFFNMHAZULJJHRKJYIFBLQRNCX MAGIWVIJUHKAHXQDTLXHSASJLFRSTVJXMQCKOQRS WNITQBSUFQJIUIDAPKEWGMBZPHALVOANJSTYDRHH WMGZEHYQSLQZRJXOLMPDWMDGFNCXKXPZYSJQCZCD PNWVQVEPLSRUPWTWJRUPZDALYGGHLDGSVNLKCYTA EOCTUJEONRZGUGNRTYIKAAUZJBOXJKQSHYCYSWZN BEWVTWLFJBLQYSEQXSNLYBNBTJZQFVHMEASOZNZD UXOINYXWJCAZNPBJEZNSDEQWKGTLBGHJOQZYDMTU EEJUUNAQKFVKBEUOYIIXJTHZXAHTWIMIJQFPEDKO TLQUEKDIKALGWZPZHMWHDTCWTZUMCRPJTCBEUIZT APBOSEQJRGEIZRUEODZIJDBUWSXCFHSDMRRLFAGJ NNBZILOEQQWSHNGXPAQGWTADVJIQMDOPQMVPXRYC XTRLEJLRRSENBGIBHHZCGTQSFIRCEWUFVHOLXVFV CVXJRPYIFXKKLBIAYECJVROIYKDTKAHYDTEGVGFM FIEJAHIGGYZPFYSVKZCKURFSXZXSNVTHODRZLDNA SNEOFIYHZFZNQVUJJFKXPWIFRYTDNCRRVWXGVGAQ GMTRXWLLUQJKCSIGHTBJUOAFLTSGMMGRHOVQVTCM QXBIHWWEJNFHFSBJPLZL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      BETMCRBBTFYOCCIWNODMQCKFPUOSSGZPWPOHHJAO YZXNOOARSGTRGYZCJLCKZAQURGKPOLIHYJWANXMT HGROVBQYKJUMJNXUFPQPIFZJHOTYJOMFAKEBSRJF DGCEJYQYRBVTDPJBYRPXWNQNWAHDPARZKEHZIXLF JGUBDVIBOYFJEZDVJEDRDHXKCHQKWZKHEQXUDUZN BXADBAFRQRIQFDRAUICJUKTDGUCZPEYLCVWVVXKX OWTOKYZBYFUFWCIODCCIWLKOXZNCQXXSGLTPNHBK FFHEINKKJSXXJLSTSUXOBLWKCOPBPQNWSFXEWBHG CQDBNRJARYGHRTRHSTPRTHIOPRWATZKXXQQJUBXX ODSELPBXIBBSFGZJKZLSCYQSLQXXIYYIRYWSSDIQ IJTCZYTLFQCVEIVEWSDTQJIUNWPJWCDOJBVMAVHQ FIIPWVULTVMHSEHRDUOMZUXZFXMXOHJMHKMDADWI ONUFHYJNMNLLYHIFLGSHMLAUZKUCYXZRIDQAHBHO JFAGFNVIKBDYDIIWEVIKQCQDEOYZTBXTLTHOBQQG CLASRFWVZNBQCMGPWBIERSSCTYIVNBOJMRXNJVPF MOLZHDFHUUFBOUCPSGNVNLXDQXBNTCITXSZEHUOP RCSBAMOSYVPRTEPEAYULHCBAHZWIVELFGZRUUXZK BNQCGVUUGBDLVHKGAEUEZAOPODNSBUULJOVQVDOS WAQYNDAFXTBVVUQUDLISDKFGDEIIPBLLVTHNHXIJ HFQEUKPFUUMDGLSPFMYGCPWXABFPZOYDJEADQBKK JQJKWNACXDKCBMRIOVYJKJLKHSWOGZBUZGHCXTBY YJJKFJOWKYNENTJIDLHBKVGERETHFNRWEKPMNNZO DSSDVWOMAAOTQHTRXBLFDXDTPLDPWBLWGOWBVAMG AERKBWSERGLIFOAIRGSOWNEDBTJKYKDQVIWBCKQK MHPAWFGORNNNVMMWTILBIQCKMSQEVSVKSEXQRZNA DNAJYBCCZUIKSWSBXEXFMAINBRLUGFAGQMBQUMAA WGESCYNHJPMMOWMFWTDLPLLHZNXAYQEUNJOWICNF NUDBSHMLQLQLBZNJVJCPPRDFZIFMEBICEJXAMMWJ XULZKBGEICGQGXNCOFTBYPARTWGCCVKZJCVCKDJA LGPHZDAZFABJPWYILSOLQMNPXKUBSIJRSHYRLLAK LISNEPCEJSJIQCDUWVAQGQZVPXLFTANVSLQICUDZ TEXKSABUTRGCCHDDEOFPVCIGKVIATFNYBNIRKHBK NYVJXCGUUKBEWKXTPAXTBAKVIPRATLOPBUWRWKGE UBKOQAJYXBLALXVXTLUECQBUAAIYKTOGWQJCHHTT QAMOFRVIUWSHLOHFAGIGSIZXBBUAZLZIXXYCYAMR SJFWZCIBEOIKSLGKSFHDXPIUAASEOQJELGZUCDLZ TMARCIXWYYBINUOTQVSUELYASIXIGKJWPBJLMQKS GDRHCLTIWKZHXKIIAFUIQODZNWRUSZZMUVNASTIJ LEJKTANOHLYLBZIIRALJUHEGLBEHBCXQXKHARUWG XXGBWOYLLPDAJOPKPOYSMNYMHHEADYDBGUKAKILZ UTVOQRHPVCIQEATLCIQDRDCMKPOKNQSOLKTACBSN WTIZDISTHLHGYAHFVLBTUKLNLNLLALXHKSQEOOIT ZLRJFZZNZAKCAJFYBCNEKVMWXKITQOFPYCLXYSSM WZSUDRUHOYDORKZOGCGQMYFQRSOBVCWBYXRKONOA TBCJVSZZPSXKNTPHBVFFLULYRWFGYEECJMEQWBOR JLRZBVVFZBPKWDXKVAVUFJUMDZMAHQNWAGXOQOBW QKMKESJFDPKUTVKCHHKHDKTMCMRVZTBPMBWBUQLH QXADWGSUKESMSAIXWRES
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WQTBASNRFAEBSBBRAXEJFGJPPULGZFIZCKQWYUPK OCOHZMXZMCKVCOLAXWOWHRRLZASTHGVKERPUUUHV RCQZETLGWOOLFIGAVTXSCNIIIVNONHVZYZTEVKVW QLLFSORYMCXSCJIPSZYIZVMKGCECGYQEEPYISHYG JIFLLRASQXQYHEHMLUPFWFQXDQLSWIPYMDULGKUA KOVKIURBKTRFRGBDUVHIIHTOWZOPYHUXSOOLQZVX LMTOZMPMPXLMNFDDQKCNQTLISAQGPKZXXCQNTVHX HJSCHMXNEYJNIOZXVCJSLLTMWKDDUANALDFFXYLG LOQGRDGDMKYYCTLJYTYIGWQGKUOMOFYBHYBVOPWL NTTOACFCQMIQEJAQHQQGQTJVMKAJIVWCBAVKWUQO UIJGCUMBJRDHSDPEKPPVKPABQPZABKXMVSJTEMRY RSZWXCKBFXPDCQXJDWDDFFASXGIMQZUJYTHGKECF GDSPSZLLWCINDAIDKVXJSVQUZLTJWGGFGYVFAQZF POPDRFLOVZHPAWLGPHBKJYOBBHUUQLGHFREQDVTC RTYAKNLKFIPZBXAULKSUVKKDZECFAXQBLDRMIYRB RNMKAMPNFKLAIGSJTWFDOKZVVWMDCQRCVVUCWXXU OYGORTHVOPHGLUUHDDINIWLJHEREXVIECDSJRLBU EDEESHBBGEIGKRTYPIDWWJNXDNWGFYTIXOTDNFWP DKXIWEBUGHWLAJACUEOSQZVESPFEXRSOWIYBFBSL FVMSDLBHNFSLJVAWAACCPWVWOWKPEUGONYJXACCG WNVLGXPRMRATWNBVWCKUPRCTTDQVYMMOEWPVYVMT TPYXRMDUIXRWVJEOJASNCLXTLDUZAEWFPDRNWJWS EBCMZYRTGKTMVNWNUWYOWHXBYRZCIXUPIAXOFIZF AKHBNZSVPDNZEJQJVRZHPJROCOQSMXMWHYNUZYNG EYVBHGAKDNANISMQKAVQBQFFSUHAHMTKDIORQKSJ DFKDQINYLXZAAUAQYUZTLCLLAEGHUUTSQTVEOFZW GHEBYBLWSQITTJVETYAMMYPEBQJLCNXNFUKNCLPQ CZNZWSQLHICHLRJXJVPISLIHZUMJMCMTDNGERAOY LOTXSINQFUBPVBTQKPAPWWJONECBOMHWZHYNRRDQ SZIVKUOBNSNUBBTAJIJBKIJBZXAQCBKPNRVPDYAF IVPNMTRRVDOUYOPEWVLUKRRSPNGJSRGYOAQENDWX NXMTTNFPLXRSBAEZHERDMSRPRIGZORAVRNQEZHSJ ZRELNKHTSZQXBKPTJWTGZPIWQZQUMIARPBKAKMJR KLWWYDZRYLEEUZXPCHZQAHFUWRDOQMBODSIJYBBW XSWQBRSUBQGXRMHUZWPWXFOXOUXKJZFTSOJDKTIS WPHZPSWXCOKEVCFSJAIZYEVDTRGBDGHWNTTDZHLJ DJIBQEOAKLYHSUNKUCJKBUYUDFBDLHRXNEGGXHKL XAWCAYESGGVCNFSKSYVEDHSLRCVIWCNWHRXXHUCS CVNDHTMSPVNDJFZDFSBPUDNTYCXSHZIRVUXVYEJO URGTJXKAQOSDSKUKEXWXTWWXVBHATPZVDRYOUYUP QADCYFXULDAMDWRRIKQNNNCRDIDPOFTLVLKCCRZO YWWYFPAIKYMJEQCVXWLFTAKHOWRCGODCEJGFSDJK UOVGUWQLJYYIDOONNNNADGGSXYAOCSZHBUKYEQJP KBJCLMONLBVOXAIFCZVQKGLTXIMOEKCCPDGFWVMU JLLFGPPIBMAUKLVPUDVXNGDETNJWDDYYKOVMHKVJ XNFMQPDGDGAJGHFGYUMARDXCWCDPKGCFLEAVDYAT AJMAMERYYRQGZVBGIDGHXEMNFSDHTTSAESSMOUEL FUTEQHEBNHKVLANTGBAP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MCWCMIVXEIBOHJCHJQBCMUFHDQCLWDYRVQOSBLEI AJFBXZTIDFVPLKYWNIRPMTNTJAOTRJPKXQGOUVCO KQVNBTVKUEFGODXYQQWCKEXPDEHCMTPADEEVBJKJ LCBULNDYYRRPYQDFLEQBEAKSLGUFIKFSUKXKEYHI SWHEGDVNFFKJHHTDGZMUNHPTPVQTDIIFZNRJUSDK EVLRVRAIBDHTUPFVQIKGKTZNHUKZHFCETQBSDZSE SIZITNDVTRRIDIEPZOURZWLFHYUCHXQJUGNADMUG LUJLOUAUZAZOFXXFQRGSVLUNVPDCEUCKCNJKNVVN TFOROTBMTQQMYQJFNWIJDCSFWPQLSDXYFBIUKXVL PCIVSEPEXWBALQRKPQETAQKBJQBKFGJOGBTUTMVK UKMOKNSYVVEYFRRPLRGOESOODTDQIBBYMHHVXZGT BBSLARLKXXNEFFPEAITQOZNDHZGHETWOTLGVBPVV OOZRGDRQRKJVAQGLWDBRAUYRZIXQRADNUIKKWYEK SQBPQEPDWYXIXKQJXNCVLLULJTHUAAFORIUAVBWD QPPVXPZAXGWUMDEDWSJPZGKKUUGYUMLBZYCMLMFW MNQSLOTNVNXDYRLZXUNVZFBHBQZVDVDHWKZDTKEL YYTBEATFHCOIAJRHCSWZLMWZGLEQOTNTXBROJMNA POIUFPCXWUSNWBWOYLQQDEQRSATERYCGGYXUNKHL GKUFWAMKBHTLUQPDNKRVZLHTLDMDYOYZTFCWTDQK SSXQMTOCIJEQIDBVVMXVTKAUYPJLPELCOVXTERWE XLIIXSTXGYBJTBQDLADFJQVPJHCCEHMVGMKTAEQD SPIULGETQDOTYVHANYLWCLKZHENOGJBBUZIUQNOX IWELTLVYKKNGAQZNXHVZAPGFSHYGZYAUPOXISTNJ URNMOSYJIDKXSCLFOOQNZCBQNCKIEWRFYMKBVWVA HDDRSZMUGQBBXHVHPSLQRWEDKTKEMDDFFTHWKXJB EOZZGDFLVACPYCPIKMXSLPRGZDGZFDNNHYXNDARF NHIDHAVIPVYKAWMNVMPTNRKOBCQITRWVUSDYNMFB RMJIKTAMDUKKVSSZKIZQBAGEWEKBLANVOFYGRPTU NEUSEHXVWPATTTNITVIGCERVELCWKRRCFKEDVJHO MDRYONRNIOPHAGGWVXMRSVFQIFBYDQNKWPWCRHTX HXYCTAJIYBRYJTVNCWEPWQSSLKAWGKTDSAFQTDJK VTKRCZLHRKWCWEZIGWPOTBUOIBNEEWTQYGAJNTHD EOKJUUZTXPDAIXUAWDZDVZAKSBQUOSSVVRNPGWDD VKHGHHWOQCWFWFNORDXOKECXBTVMNDMQCFVMYLJU MAUIHIABRARJMOEHDBRSOMVZWRHXKPWOKOBRIVHB ZTDSCGPBRYRFUNKRNVSVGDLDIGNYNDEQALRACOEA WITTLCPCKDCTIUJWRGGLDJYYXJNEJENYLRHMNTUZ SEKJLLBCFKOSKLCIEWEYEZGDHIXDJWGNOZPRJUQU DDRFNOKLIGQECVMCAMYKBMKJDKTDGDFQWQGXHEZM GKPHOJAISUSSEDOJGVIAUXYFQPXYQWYARRPDBFZV ZRDYHNISZLBHNKEOHBORWGMQCMHWLJLTVFSLFRIP UOZRMYCIKQBEBOBFSJQVADLBJJJIYQVGDZOVKQEM RLVIICFGZFHBCXGNLHXCANOFZMIBKSPRRBJCBVGE MXLOWXHVEJYPOOIIPYBWBOQBCGHSPMTMKCFCQQCP ZMNYFUUSORUDKNHRAFHYHXJEHETQNCFGWXAFALHR KEBFKSQQCPWKDQIFQNFBEHNMARDZQHBHSPNMRYGN VOYJZPNAULWXRIGBHAZKIPOPAPGHYPIPPQQUYUSD ABOAUECZUXWAQLHNBAIC
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PEUGMHUTTTPJRJGHUHMTAWKXLOEFSTVXLEQJDCTC AHTJCEUZDDZDGNRIVJLHNDNOKCJPBMLLICGDPTFH FKBIUODTHYAJWIAFKUSZZPKWUGJNWSPOQDWWLBWM ONPZELYPFOLWQITYJLNMMLBHXJQKCBBHDNAUSSFC HIYCYLIWFHYMTOMNXFEDGNKZLWBTZPWBAWVHNSFM CYGDNYAVLPVJHVCSNRYRVMHEUXTLPTSRGGZFEYLZ IRVQHYFPARZKIYYCTYTCMEYPTUHGZZJNOUZWAMME WGKINSABHWDDXGKOIEVJRGJFQZLGMHVSIZDXXYNT XBKFNXKWFJBNRJILFCAYUNYXMRKEVLOSSKOUYZVI CUSXTTFUOHSHEUFWUEKUFVLHIWMCKVDOUATFGKRL KTURETRJVUUIRLGTHWEMPIYXNRONBGONHWDSPUIW UWZKFQXZWURGLBXQKXRNGBTTKRDFYNCNZENVTJJJ SUMWRKEXRTSQYDSWTDXHANGENHIYGMWJIGFEIQAL IMRZBUXSUJYIWGBWOTPYOZETZADZDTCAPZDJFOMP RMJUUBTEGZRLCCXGHZHOIWZRBXAVATQZCUSWLLUE TYJHZGIMGCXCOGBDGGFEHOUSHNNATUCNODOUAZCB WRNXVFZOVCBAKSVSEHWJCRDKBVRUOXRUEABRSAJB WCSCVPGVOONLNZCBPKDOFWREXMUXUWOXXDBIVAZO BMWMIDXGJBUSVLMXYWHANKBCGNLZTOTVDONIXIAZ VQKMDALWRAJQIFSMMCHLOCVBCYRQMKQLQTPMIPRI LFQNTXFZYOLBBMLIAJYUIZHWFOXZIQBIAGTQJJSL UJLAYGHTWMUFIVATONXBHLQEYOPIFAGFCXJNROME ISXFHWGTTTYPWCWKNOOCBLDSYWJECIKXFWCKSBXI WWRGPOFHOGUGWDPFXVZFWBWBLDIRZASRCEVMMOHE PVOGAJGYPPSNTXLXAVPTSYVPZLGEEWNMKGUFQRWR IRPGJFPIAXIFJAHCWGHCUCXXKDOUYETDGMXQOUAQ CLDACNVQVLNHTKMBUSZKPZQXQQNYKJJHTDVGTAGI POZTVKOJCPSOJVNBWZHTRNXBKOFLBWLCXUWQAFKW MZIZWLLQELMOCMNLYQIQWOKYNAOYQQZESRQXNFYM DQYAXXJYSTBCEFXUDLJSCRUIBSVNAVXRSYULGHQI VONBBBMMBKGRMCXIVXPYIRZFQSRTRTEWNTIWXYYW WVBYWPIWRKQZNNLOZMJONXUTVSYUZSJIBUWMAWRM VVCPWIKDDKJTZNZZKRMEUJYZGIXPHIPMJTMZQFNP KVGGHVVEARACVGZFCSXKKHYWLOWIDXYXZPJUYTHL WVWWOVLNOKMAOLGECZHLSLWPAXIGPJGFPVHVIFBV EQHXVEWPWNNCOJNVWIFJZXRRZLPSEZZNWCNMZKWP NAGFXROXSXRKDTHCKIRNGHCIWCIVCEDOXPSTXYXD VAFEZAYABTEYLRUMPCRBPGPPVEEKJGPHLQZXGEOG AJXZGWPRWFASVPARFCWWJMFJXMYUYVKERQEMUANL MRAEPQNSBTXWVHQFBRSSGNRDAGEDJMOPQQSWULCO TEXWUGRZNCWUECBHCQNEWIDKGNDTOHSVACNRSOAH LUVZRIUZMTPACVDYWPKCRLKMTDZJFOEMFXMAAHNY HLCJPQERGUAIOBIFZTUNIAPOCJEQBDZWYAWGPIKC MYLGLVGKBQYAXYRUTAKBHPHHLHYDISIJNYHFUKUT BAZHOEWOJHJFCNUYIASVQZSPVDUMCBPYMSLRBXGE KSNLXJSQNDPHCCHYYLRAYNIXXGEDBXHZYQLJMXMI HZPHUPWALPTNONOWOTCJPJZPWKZRDUCGVLTMAWFM RGGVHOYTEHXKNAOHGRVG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RCAYNBSRUTOQZESWUGHCSWOLHEFZWDXBMRQJNWCZ DARAJYSFQQRYZOSLLHQZYGWXCDRJQWGHKOOKVTLE HCNMDVWXTKAFJCSWYVCUSRPWSMJSKJMVKTOATURR UCNCGLFFZGVDLIGJPXKBXVJFTPDHKRQWMZPHXGYL YGXGSGYCPAIPYMMPCZTWVMMMODWCSMNLJSJTXYOY XNTDMPUUZMUXTFRCIXPVBQTKSBKNIUKOGLTTKSXV ZNFQQAIPBHLDYIDIBPHUQDUGGWVAIBZVURSVMYBD HNTPVZYQEYMMLFZJKGMOGNLQOOMBLTBUGYXLOEUH IEQKFHADKEGQAKDNALPZNSPHQJIFMEDQYHXHHYTA STQAUWIJWDPNHYSDGHLDUOPRTFVDISYWGYCAGVYY TDTEBTECMHERQSPVWNQKHAHXRXDCLDXJRNBAWFAC PLRMAUSOBILEKMYAUCIBZVSWLFGDQRDZOYJSEOHO ZCQRXIAMDZRUZUVQEPPMVTJQQIZDGIVMEUXEIYYU TNZICNRCFJVCXNHWCEIRTJNZODJBBAITVGMCJXUU REUJSIMEENXCZWWBBKNUTDLQSUHADNIBJLZGOERA GEPTMPPILJJNZTZQWJDKLICUHXJGUZGNRAKJBKZM MFOWHZAVJMKXKFNMLHFGIPNHRFOHJPCZCECJHPGU GNXEDHXRGAWWRGGGFGQNCCELGCQHOBRYJARJGSBV ZILEVKHPHMOBOVTAWXQHRQIPUTYOUMUQIDAOWBPD SKEOJAPCSLMDGSPUFNNANXNJUOMQDNHKBJGBIVUC GLKDYOXJLZHWPATVFUTASORFZLNFPNHTFIODGXJP UOSHEEGOXSYHZIVTJLTNEXAASEKELGFASCJCSTRV OVJCUJNTFCHBCWXXAEFGFNPSRLHWPPXOGCKSDJVT ZJCMEUITBQNTOKBUASSZACMCKUDZBHTTZKIRVYEM WJMXZQGYRKNXHTPOOXTAMKDBUDVLPCEAFATDVYSO ICQNBOEKIAGOIJUQJOFMIKJEUQRAHDYVJSSJBPVU RJBWRXYMBVOEVCNNZOZJJVSRLWYPYQGHCVBGAFLL ZZYPLMJSYLSKJMSYVLOROFCLXLKSBAVSAYAGHXTL FSXKUNJHMMFHVYPXJZURXQURYZYKABUOFNRMDJUV UCWUSGLCVIMBWDCAUDXWXTBNCAGBSNEDOPYKLSHB HLEJBDHZQBVKTZIOYMULBLGLCAGHBQJWHKBTKEIQ OGMKSXXPGIBBPTAIAZFEACEURHCFCNIEFXKFZTVS WZKOHNWAZSMEJQHUNFOVSZCOOULFSGBXSOUXFCPU KITPWNFWPZAYIPUXJRVQJRKMFINNXKGZMZWOLAUX SONPULKLMJURYFIBWUJHNJZKFZFFOKDMNEPSYIDT PNDDVTSATAPQDTMHWWUHJODHSHRFIOPXMUOWXEFL LDHVREIQHMWBJMYSWIRXZQXVVOPYOGRBMNPZSHRK TNDBGTOMVPYDYRJRCHVVIFASCUKBIZWIUOCENDTN DBYMLTBWYOVBCSHIVCNVIAPBXOQPATDXXZVCCRMG TGREQZQKUVUFWCVPLHKAAVXGRVJMZMJCDKMQEJRN IADMTDEPTWORMVCJFZURHFGXBZWAIFZVJFSHGRHU LKOAYRDQTRSHGQAVELUEFRKFFWQYHLXYJHNNQGTG UGRQULYHHTSWLHOIJLYNPRMVTMPQOZFLSWHCPRJY EGYCPSKCMDVIRXOYJWVNXORQLTAPFPXLRJRMEGEM XACGTFRKHUWPTLIYBVUQYZLMSENZVKRZKICUHZPA UUTZEXUUEVMZAVUTKZCEZJLMOFARAEEANTQIUPLP ZAMGETAYYRNHKWNUDZNVCVGGRIKBGBJGVRGOOQGL LGWAQJYVQXAQRDRTSJUB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DCMSZHJTZHZIKFBRGMPZWOVCDZRPNHFJLAAKPSDR MAHVZINOHOOPYDJSDSHMCNFCVAVZUNKPPYMDERMT UAIYUPAATTOSKORXYRQUNCWFVCENTKWDSLCZOVXC IGZTSKJPCGNLDOFWPPDFWLPKVLWNDQOUXKBAIJGG NZIBESYQWCHDGYGLQSBYYHPOKDATLBGKKGKCHIXK KZDXZNZNIPUAXHZXTTSLEWPVCGDESRPPEFVTFISR EPFKKLWLWGRODNENWGHOEUEQCPNSAVMGYGCGHDKZ ZOBUBNSRZOWMWAFJIFFSCWZQMWUVQDBFPYZEHLDT LVLEQPPGHNNITNXAVFDQLRYHRRJLAURDOYTDEREP IBARWCDCTUPHCHUJTKIMYOXTMYQHVNBHANALYTPE KKGVQEXYSAHUIACLRZNIDQRSXWCSHHITLLGTJHMJ ERRUXDCJHHPSCBQMRMSRFNLXMUTHPWDWGFWEPWBY ELJJQSPCZVCCMQKZUXWYOEFGAXNCRRZQPNGUIQGW KCIBBPYUHKKHQFIVOOZXVEQYLDZYAXTHPCCTAVTA RBISUKTPMTYWUBBWHQAOZJHOTLEDCGLZFEWQPJSH IMTVMCHZQZGQFPKZRRDXVQUAFTBIINWQNIREEZXE XXRIFEKELLAIKIHDFVYETPWPPCXTQECGGFHZBPCS UTNEKENNWLKJMSPHUUZUHCAOMJPZOYKGRNVGHIAL OJINROAUBZGJIGKUDIATMLVYHMEZSFGXVEILSLCB BTFGEHPVDIUANJTTMKPCGLRHXJFQWDYXXNIZVVMY ONTGYLHLLTEZYGGDFZVBBKNDDVQHWORCDFOLWZJK OQNRUHNKHAXLNWFYMHTIKAUSRUFDZXOZOFYPBMCN QLVXRHKASJZQRHDKHOVCWJPVNVWBJGSPONCVFPRU MOXWNRBTBBRJGQUCLZTZPUSBNEJENTJVDNUWCKNJ WWXAIGZJJHYKZNSGFGLLCTFIUZVWMBWKAQGOPVZD TNWDCTLDQVHQCUQPITXRJVKFBOXYUNDGYPWCTYZB DMSTAVNVPRMPGFVNMIATNAJYXFEHNHRPMCSRZGPA XEMHQYZGKVEHMBUEEMCFVZCVGGVVUSKYMJQJOMLW VZUCUEKJBHEAWMAWGWRQOWEPBTVRKAKFUDCZVCIK LVXLVGIUSWIQYDNYJWUQXXWLWACKKHIOVNXLUOQK QFWQPUYFVPYOINNJPTOEIDIMCUBKDFMABNYTGPCD JJSUXUQUCTLIVOZONGSZCDGHKWXEMVRQKORLEJQC TWNGRTWCJGBHQTZRMTHQNWFHIAWCBYPBNITZDAKW CWDQTZRHYELQYYVBWKHVHOIILKVMPKRJJTMSBWZI QVJNKAHPQAJQOKVQFZMFLVGPLSTZOEOKUCMAMOOP MJXNQQRGDECMWMIRDLSHCRZWGNDFMBDCWDSXWLZS ARFTUOGBBZEIPMOQDAPYUXCRDNZWDDLRZPSULSSR NKYSOSPRTERCEDQLSXADOXFSVKWOEMLXBQITVYJX ANILSDNCFYWKANNBQPUWVDROZVHXNVZUNOYIIAWG DETOGLOWLDJJWIMHGZGVYKKLYOESFEBLZIMPTWBM OCLXIKILGUZSTIQYXMGCLMAKLLOZGEFTPRIAKUJN SGWOZTRGWNEIRNNPBSWWRZHJSAKXBBNUJYZZEPHR XMQDBSNLIELQJZCMZMUUWVUVPCHLMACZYAMAMMHK LIMQLUUHUJTUFFXNBFPJUDKDKTYIMKYZWLALJXVC UYKXJRNSLOUSMUOSETPRPXUGLRRHBCZJHJFRVLWI AFXWTTVFCEWLIYBGVEBKYBDVKNKJGZDJKGNXWMFM CBXINIGVXJPVDMDYEWGTQJZCXARYDWWXJUSCBBFG YXELKYQCURERXVISLHLH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GBLMWRAQCLNPEIBTFFWYYBFMAYSGGQEDHPBRDVMA SEHZFXZNDZRDKVCJQVFBOVRQCMQGGGEYOANBYHQX NSYARMVJEJBKDEGBYZNTBFNKLMNWNGPGDYMQGOFU JWIXNGHIAORMKOYRYCFWMIADEINWCUIIEWEVBRKY UYHQAJJUXIINOZPBIGREFZAHYHNOFVFZPVXOTEAM MYKWUIOAYVBMABVJDMTUTUZKBTTXDYPERDRNEBYY BVXVQMRLKUYNNOBPXGCSPOSSJLWEEHLLNZSOCBVA XSOADQQUKYIIZXQZDKZDBTWFCDFSWYBSSSLQHARN DWIZYZSYZNGDHFULUWWUKBUUQYPRHFZVLBDOMSXV UYTNYHLFIRBGVSCBLZLTOFHWIQMZAJVMRISTBJXA FCLXREWVZPBNTZXFTVPOWJWYTSVPKAJRWCRBHOXJ CJZKJYFWRRYKLZARABUJHJDNOEIXOFEJROYBSYMO MYEMIMYRYTDGYKLQXKWSKXFTBETBHSOMGJZISTHM NOVYMDKYNXIQIXDJOVHHCRKZQORRZGBZSKZENPKA ZOSLTZYXZPXHOHQTULAWAIOYUMGFKKLJUBKRTFQT IORPJYLCPSUEMWIOVQVNQKLEQMFZFTJITMRWMPDM PDGLHGKIXTKTSJZCVMJTSGIZDNLCIYRGNBTDVPSP BXXZZJWGRVAFZNSUJBNJMNXYLJQAYRNZKCZUSIST HWZGAJRFGXCIFVYEXISJUNFRJPQDOMNXIPVWNNGC BDYFRQNXHOSMLCQKEXEIRUAUJZRGCSTBMDWJJHXP IAYZTMZKMNGVCCDIZZVPUCTVJWOKUGSMPVISKJTB VQPZVWBEXZMNAZRPWFIMZPRGBILAETPLIRHKXQZD NAZBYXKRIWYWAGESEMIHSEDHBFHFBLHLACFFCVDI XHHSTLJAONAQFWQDQQSCDQCZAFVIMRQFYMDCXULY UIXDWVFQLJFVTSAXSPMYYLWEHKZOHJGVSFYJBNRN QZAOCKUBIGBRPWKPEZDHOEUVYHUQMCIQHSOUALQI VFDCCAAJQOJPZVREUYYLLJSKNRHFJRVNIVPNWRMC MWRCVJYIOOCXRTHMUBEWHNRKPJRKUJOSOWYBMYJO LJUMQXGFFMEMIOMYYUXLFVOTPGYXJWDSHAJVRIAS SWORQHLVDJJNFNJWRXKAHWVYILZDPTMTHNMQFTLV LWUGXZJMLOOLXECEUJLULRPAEMGUPIAWTFXYXQUA MDCSIULOSJVOYJCXSLXMFDKVVKYJNYIHCLLWSIIB IESBBQIXWNZFYXHOVVJEQXBADDYVWWPORHPUMZUN HOMFTSJBLIQYCVXKPSASJOKDYMGSYBWOIZFRSJJL BHIYDUFLARXHWRUTAZFGKRYQSZFWZJOZRWTVIJFY AXQFRFJKGODCYYHUPGAFHJLPKXCZKTLTEUSWPHDD NNUVQXCYTHUYVUSYHXQGUAUJRFZILGXYSWGWBILH TFXKBEHFCENFHTZYJLKRIPEYPPSVGXCYQEBMEZYS JGDIPLSELEUPNTDAXCOWQAEAGYISKDOQXEBEXQZF EEBOSANAZOJJBHDSXDSYJSBBIYCUUOAROHXDHGQQ JFGYSTSGTGKQXDZHNIODTHNHVBBSTJINJMBOUPWH SUOYOKOLMABDLDIXKXTQAJWJIXDNGWBCCOYYAYVO AAGLBKPRTMSIXJDNVFUHMUINWQIWJEYDSGJPGNZD ZQNSNSERNVAQEGDHFSOLBRBOARELYIXMBZTQCJEL SGMRXMMDUNMQXGDDMULFDOBTQRAHAXEQNGUWPKER XXDKOKQTHHVLBQFBIVITDAGRQSJLVVLTYXMDVXXF DNEOFDVFZKGYUIFMIQRGKRGGUHQWMLQCTWEECKUR VEWGOHPMXMMNDVSEQKSU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HURMFWJKKGFRMPQMCMIKJBMBVLFJTRIRCPUJIUJC QWBNXYCMVATMMPWBIJRNIJMAMSTQLHBYUUULBCRU LTYEKGBPINWQLQSPAOTBLHNVLDIFZLZIJQYJOPRC ANXYOWSGCVBWRYSLQUROHIOMFOFPNUKQYGHPWWXX KJZVVZWSENHDKYJDSJTWALZMMEWYWPKMUURDGGHI UYIFRXDRHHINPBLLKZMKHZJLTWFSQVRQVAJNRHSR ZWKUVYEZMXRIOEKYXPWUJYFFBJATBSAECPWVLZVQ LDNCLVEGCXKVOCZGROVYYWRDOETQMHKHPADNYXDE QFGQWGNIAYXXTQYAYGCZJVTHTJQEQWTURSLOALXB KPHVYVNVLEXQHLFGMUEDUAIZXQXUHDSSZJCKPDEU OSAYBZNTNCARKYZLAFKSTPENSLBQREPUREDLSWTM NOUBVZRBODAUYURBMTRQIGHCGIASJKBJOSZNMOYV RCZIKIVEHXCCQCTPJOZLVRQVKGXEZVJDHQAFLMFJ KWXMDCIOQWHQRBITNYSFSZMGJCTPGQAGKSVZZNBN SHTCVIRJIEDGISYNOFPMZIEBCKYHATBZPYZDHXEK RSGCGOPLHZCBKIJCMQJTRZSDGNYHYKJYZTLFAVTP DRFFVSJVRBCAJZMQACENDUKIJIZPGWOYGZHBYPCK ZNUCOEPILHELKTYAIHRQUDHQGYHUARZFRKSWHLJK FFKCXLMCCSRNVICGETJRNXPIHHRNVIORNBPBDIKW JFNDKWUUXDFSKATLJQSADBSYHWFRGRLCRPJOZRZH NZREZZHXQRQUDEDGGYORFYCDNTVLSNSIPOJIRJHG ITKDJIKOMPYCEEMJYTVZSNMLNWDCXOJODENIZMWA HYVIFPHLZSATZCDFWFKJIXZCQQOGCCDATHWCZISJ EKOQWUCTGXHTRAMWYVDCDTHYNJUZEXKVJMKIZWDN RGJAVUQLYDWJPBFIVYCJYZOACECFTYQSWDUCKOUH ULIAFCSAIJEVKGIEGWSWDAUTWNKWPTJOXOKQMUNS MQXUSMREPKWDEPARXCSBQANECGHBADCUPNEUBBIN MHAMZNWEPUDKDKVACGVLUYHGAUCLTLJQABAYQRSE MWSBQYTVPXXDEMYAADHKHATHFVJWSBIGLREGIBJC GZFOSWFORSPBVWITLMNCUZXQPGUOFDKYKGEBTTVM KKFATWFHROLLYGODXHDOEBWIXZGUSCHZQIHTYKHL DMLNRPNKYQUSNRICUGBZLXVLZDQBAZTHXVBNGRPG QXCSPFRTDZBVSAUTDCEYUYVCKHCOFOXVWQEFWQYN SSGPJLRLUOJPCAZTOTMFLQYGXUJMQBKEYWSUFDYK KXCVYBXHWDWSLKLEGYKHWGGRFXTARUHSBOQWYJCH ANKQBXOGXTVWDBUDGCKCLFXLLMAWERYAIUSRHSCF AXUHTATYPPQOLFPEZWHWFNHXEFSTJVCZTVPWQXMI JNPGPJKQHQIKWKGYRKKGCJVHTXDEHKJQRFANBPLD GMWIWYTCXQCQMCBJZTZAJKJPRFZBJYWUGGQWFAFG WQGRBDTDKRITCKHIYQNENNNTFYCASYCLBJBSZXHL ZHFQNFDTNCJSUXUDWEBOFFPMUUAUFCVOUFQCZNCV KQGMRDUNOSOFWCSLJQONFZYGVJCCETIWYKQHFBUB IVERZZZBJGHWDHFVRIVEJRZNZRFSCDPSNCSEEIZU VANNKBHOOTPSWFTAYYPEMEPNDESFJTMFJJRDFRYO IOEIVTAYHDUSDVQPPUOLJDXRRBXGQNOTLIVDMNJY KIVUXMBMNKSBGOYCWDZBHEEZAVYEMOSXWLMOVGZZ KKXKZRYRCCYAUNEDCBFIHVEMXXSSSGTPZDMBKVYO HFICWQFNSNANCWRPSRCM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QVSJZTJQPZSVHNIXXJXZKJCAURYWPFAGWUKLPKEW PFVEYCTSPAONCFFJAQQBPXEISYCNOHEVTUJEQBPO FGQQCVSVJSSEPGWZKZHTHXCIZDBKQXHLNSBFSHMK FBFYXNEIVKUKOMCMFIOOCBFIWRBNEGRNZTGHTQEA UMKOISLACGNKVZCVGKHGIWMIZBTDYWMTEMWHDJMF ARGHIQJCFVGADZXRVMTQNXPAMQYCACDRLNRRVRLG SDLHALMFNYNGNNVMWWNMSOUPEATKANGNVIQYEEXS SEXFGVOOBYCIVNYFWXGQXSTNDOCYIZDMWSUGDOFU IYGJTTVLTQNZDFDSRHIRRXJJKWXPFDLYVSJPVRND KYYQBUCTTIOOBMHJHMYTRKBUEQKPLXYAEPMJLZQS RUQWEGPJZRREQYMIDPVAELOHTQXZJEMGVCSHYCDN EYEUNZTJYMYXPGMHCEBRNIMYUSLEXAGQZAREANUB WVJONLVJCCUMGMAUWREOWSEJSXRDIMSKMQCOQTHL IXCYIYRZPKMTSHHHFJRCDSECUYCILBJFBYNOPZWK BHPVPIZAMFJCJHCAUSBVCZKXOGRENULLGAVHESMY LRHZTLYRFEGJSOHRXPOUFVWKWMNOQITHHWLPVNMM DUTPSZOAJMFYDVCPZKCZBHYHDUZGQSVSLVYVTIYR XMHMUQHDXNKJCNHCIHYFRUGWGQBHRFEKCETGOQOT GEEYNKIWJHARZTBDXSWWPFYXHHUXZSBZSCBMTMCW GHNQSOLOWLFWYGCSWNCMBCVRFZTFKSJCZDQKBSRX IGXQRGNITIWGQQYOWYFDYMNMKZLDDYQRFBVHHAWR TKBCAGPILZHCRZMOGDUQMYARZASKXMOEEUVRGZUC BNEKJFEJMGKBFYMJAZDVDWIECVLXNEAZJRSEUSZA QMQHRGCMVCGIKDAVTDSIBARUPDFXVYBOJZRFOHDF HQYISJASWJYGQCRGWRPOMYJEDSRMJBAFTWCFLRAB HHLXBBKNJWYCCYZYTIHMBZMJGSAPEHSSFVAQWEME KUBHVRJPWPDWLROFVDAWHBIKGDFXGDDKIGKQGJFQ DDDWCWEUSAMMTZUJGOWRWBJHIRPBOEXOADOLXJSU DIJQGILZXAEUDRRLMGARRNGPRKVFIDCMZYSAHLNN NWOQMGNYGKVXCDGTHFOHWOFYFCTEHVLICNYGWBLK PNDASSHKMSODWFWZXWGGGWKQVYFNAESJXGXYYSAU GLOLFZPBLTATXOWSODJRHQSFKEYDFFYGLXCIQDYD LFXOLACOVQFBAURRETRZNBZUPXXVVKGXBFWYYHXI QLJNUILVQCFIIPEPSJPRDIWJGJMOWAJTKHATWAFI LSGTBVTVZXJUDLPACGJURTNLRTMUDWJWJMEMQMRG HOICLHXUHYTTWQBVHVTFLQBGPPFVNENYGKNVRVVM CQUEKJBZMSVMKCIQWJZZKYEBYDXQKNAKHZLGWLCU SHIVARXKBMYRPHAPNCTRCFIHDEQNATNKCTKXIZAB VFZJRIBBBVKJSSZVBMPVBEZCHVTCCXSQYVVQSEBF HHABPRQICNLICKSCYQMKRXSNZIQWFLEROZHCMQXE GFMJCIBOEWOFESOUOSDYZWGIOQLPWXXSMGEYNSCK VOESLYPRZBKZPFPRWWIBGZUUXOJGMEDVUACSAIEF JLYOECZYXPQWJGJPQVXRYAPOTLAWDBWITQTVTMUB BSBJXBAVEFZIJPGYCEMTBQBJVZNCSMBICIYDQIGS VHNSGYODKJJMCZNYVYJJBPYBNZDWGDXPTCWUYKDW KZSHQYDEBYJQTCFSMCDGMLDFKLWYRZSJNOUOWCFK CUVSEFURUETIFRUTSUWWJBDKBWSHESYJREUBSSRN MJMTLSPFFILAIMMJQISM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      BEZGAUMNFDZZPULFAGBUIAOKOERALYKSWOGKHBNL HLXMLYWLAKIRXJEYYVERMQECQCSIUQTCODOVWYRA NXAGXGPDTQNIFUTKFCHLMRIHYOVCSZINTLXUSTUW SHGHSZHAVWWOLRXAKUNWKPPIHABIIWTFTVCQZJZP VZKQMNARXCWYBHKIYIVABYBBICSQKMKDNAQPMISJ DJDELVIUFFNZWAXPOWEYSVQNUEDLPFJCCGJJGPQK HMLLZYBVGAVDCEBQBVLTWEZJMHIXHCNEOFMQINZS OWPMJUMAQTOSONFBOSQNCFDISXYRRBSIALDVOOSH HJTJDRZRFGMJYYERQHDVOUKFQBESLCQBTTYUULCD NNXKREFVEIHGESWIOQKRWPFMTOLBXJZHJQLSALBP DHYFYESLMUHFJZSYIMUWTLBMHYQHPQMVHUXREPBX MTHAHZRPLKDUZJJCTTPZZZDHOFXMMINSRCMMJNZA ORFNSDCDTSPKCXMOGTAIKJDFEEQQGTNADHAZDZBW FFMJZSBXQTMTVCREIRHVQSBDEEXSTRTGMKPNHRVI ESIMZNJVYKJSMNREMYOMARXXTUKHKTWSZEXGMKTL ZBXQVKEDDSVLMEZNSZZFWQHHRTBYICKFRGIANJDT EGOHMKKDZGGRJDBQTKKEBONOKCQYAFTOXGQPKLOM KFVCBCUPUEKYMQEXGUNMCRHNSDSJKCMAAKTOOZGJ NIASPVEIRVLIHJMAPSSHBTUPNMMXOYJXWNWGKBVN AOCCJPRUQFNYSGKZYFPCARCSQNTVJCVZSWQIMAYB PPMOCSXNGESVLCBJPVDWLPWSMBNWSSUEOBEFTELZ NNXXYCQTNRJUEMCTURKMOOTAYPQHLPDEQPDXUZTE KBHQQWPWNDTQJQRSSJMRUXIVAFCTEHJPFOUTSJGU QJFKHIQWPSGFFWBHEIMKKSEKQRZFTCTBJWCOXXTD UPKUNZLUQJZHLLOTKKPVRYSSPCJHRGMAJVGBLWSK LUGNKOPBZEXUSWKDCGYYFIJFDKFNRYWUSTVUXEJE IMMHSAMPXSDBNBKRWMSAIDVWRUKXHAIPNMJEMUKA STSPTQBRADFKIDHNMZKEYJRDDJNNCOYDWMAEFDHO RROXMOWVAEVFWLRJJEXQYXXHQTSWFPQJBFVKHSQT IKGWLACEROEHVVGZOPKOIPEPUFHDPIDMBWZFWECS ZVGWKWXRCCPWCNOWCJQHIJRAABAAXMCRYMYCFHKM UBWSUSIDNCQIDEYZSLAVXMOVMCDQWNAGINZIEHWE AMPMKHQVLLWGOPXQIXMKSBWIXZZLCDMWSSZKFEBJ VDFZSVHPPUNRLQZDGMTZKSIVABEOAUFLYERTPVDD SOAZDJMEEIEYTESQICMFCZBDPRKCOMUJVDOYGWMX IFGUKVMMUXVDMNDUHQHYIDOFJXVVQIOXPZYDGHRR NLLACFPWSGLOEOBAUGXKAKYWXDACPZWHBDXTAHZD QMOYHTDXLWQEKAXLAXQIFPSQKMVFLCPPKTBVFASD KZPOZLBTXNVPHEMDRURFUTMKARAVHCDJIJEIKMKZ CTEZLCWYEIPRLDSNXUXQGBGNLHUTWHVKPFHLKXDK UAIXSSCKLAQLQCAVVWRALKBCVSMRXXZWKUQTFPFY OYXLECLJVCSSAXYZKNNVKKCLWENIIXGIMNMKTNHR UDFOEXYPAUENSOCMKFYXCLOFARTQTQJYXYJVUCRZ ARCTQWNGOLFKMOGAMHRVRACGBLSRVZRNAQVESGPC RTONHIWVOCOBETFSOLHAZASABRZXLSXBQDAOQUWO JSCOQSAWOSMOZWDABJOGSKYBEJIRIDBMXXXEPNUB HGDVICXJXOMGKDQTPAGDTDLIERZNXPVDXNIKYWVE FZIBUZVZDJPWCZPFCVPK
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RNDEUKTSCKZJLQJWKSGGNCZEKTZXACNEOXLNBKWU SXJOUABXYOCMBKWXWOSRRCODKNDXDGKULTYUGWXV QTNIZJFUKNEQCIDLJZJYZRHYBWDKMIMRCMGMOEYU HYPIXPUFOWSXADIVXNXHRDFHYZNKMRYLTNXGPJMX RRNMXYJUIYXSDBVINEYYHKWPQVAATDFJADDQCQRL XLYWJOHQCFSPOSXUXMLBMULQBCDMKRLBRMTCTRQZ JFXTQDPWMWKLHURXHYSCGZFPNVMFBLBKXYAPEHZB MZLVARMLMHYNRRJBZPZLBHLPUNSFIOFXEICJTTZV ANWZIOWYRCTJGAENMZCWFMQJQWFNQPPPXLAFMDAA IYKSSVOYUCRORNJSKVUPTYGYYVHFCQNWAXCCTLDP DFUUKWCTDULNXUSYXLQDLCVFDXBEJYGFFKOIWRYM EMHCNJPRFQSHSYACRMYRCLBZIFFMEFBMPLECJFPN MBODSYKMZOSMMBYXJGESAPRXTFNFUJEXYNSPVHIL LOAYUCMRBTAVMCAHKAFZSCHARELTVWVKWPIZYTNB YANBGWBOCMRESUBTOVTXFLIZLZHAUAZRBHYPONOV DYFHMQOEZINEXURSANUMWHXQVYBEQSGDACNWPFHV GEAZEULYHOSWARQZGPRIBDJTKHJJTNKANYUQLILW BLDCXGIWXASOYECRSQXGQVSNYCVREQDQKIDVECBG MMBNYZSCRFUCSGLOCGMXCDOXFPVYIGEETYUZGSTU FDCXMWUSJGFLXZNVJTPMYSLDNVVEIPDUILWGKRZH MPIXVPNVMEMEBOWWFGSQAAIRKRXDLJMTFCJYALEI KUGKWBMRPYVLXKKKXPPJIDJZGQZHISNHNZXWAVDW LQTBMLQFLXAJNYQVMURSWUFSYGHLOJDIQNOCSKKA XKXSHYEJGJGRFBREDEXIEQFFQBOXLZVOOECSWOKI SMKSZFAOLWKCOBEXGQINHCIIDUYOHMUSWQYFIPMZ PZXGFELPXSQHOCRCCLUMXRLXVWLJCKKWYZNCOQFS LXHVIOJNQVWSDGJNZNPHWFYIHZITJLDBHIACNIUU OLSZXFXARUUKMBXJULNFILVDGRJDSHENKBXLFCBN PFZSAUFBLZOHTHUOVTZNZYHCTRXXYZTWNYGUURLK SOKXKAZLJMPHIINTMXBJRLXLHPUZJEZJYKKPIBKT XVJDGNEBWGVXDLFGXHAFIIQELRHMYTBEBXBTNIVW LBLKGHLGLWVSJZDLEOPXPRDYBQIFYUSHFBZNPNAW OGIJVFMBGEVAWCIKBCRYEIPIVQACQDWIWMQUXAKI AUUSJOJXCINFQPFFHDGUYUQZHEZMIOMVXJSEDSEV QWFQSGPTVILKNWMKWTSUNNNBZPRMBFXBPFDZIUFL EXYMWMSYHOAOAMXAFWRTRCYHIVWCIPRILAXMFVOZ GUMOXJPCUVEEDTGFNGWJNCHJBDDLHVSSAXNTXDHT YLEMJREBVOEMZVNLZEABPZWPQMKRQKDWAGGETRFD CLEULAIADYQOWTDIACQKWIDWSBFOUOKEJUSLEGVF KOTPAAUFVSOXYQKYIOVWHQJYJZYQZHFDGHQYSZFM EGYOYXSXVCRDPCTFQFJDDHEOYDVAAAMHLHODMSYL HHYUQSHXHGALVSLBPWTTBSFPAGSLASAISURPXFAB HIFQVIHCKSULVXCAXCAMUEIXQBCCEAZSVALIADAT FZHEBFQIACBXTBMYJRQJPSSMBMRSPAPDYMFLIVSN VSUGEQXMUNBDDUKBUHYHBEVOPLRHRTXHDQWDWVUS KWDBMZETMGOZASVMNPZXZVMBUFAXQRWOCNEKXAFG YYYEXCDJDPKXICCIWGYASGEHUOTOSOWVZLLDAATK NWTFGADVAOJSAVSIHFQD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GWKIIVVVKESXYSUWGSZDAPWBDJILQIOWHLMSROXH OUGYSSAIUUZMYHSRYVEOVHRLHPLCDQZUMGYYPBNR QRZXRFYIVPBDUCKAXKDAYLYVHPDCKVDXVLVWQEUL BUBLDDKXIFJCVOIEBHEVKWVXDCBWAXNKRNEYWRTH QIWXFJPJZPOCVPYSQWIZHEUEBZDEQVWGHFGNAUZN VOEZJGUJLYFUGTNFEPDGLDREIPYYLZYPVYBEJZAE VFCAOCWMJJVFISDUDUJFGREJLOSWWZRVXREGKRVY HONPGKWOVLMYHGCTEUVDPJMFNIZXJKVYKYGEGKMJ DEGSNCZBKTNKYPCPJCPFKQNCERGQPBXFVZEJXWVM QOZZBEJZIWMQYERKEKPGOOUVWPGMLQEBBVREERYB DIPLIBSOTIBYKQYXKHLTYOTDOJXKHNMHWDHXILDO UZIHPMMVAMVNCGHHGAEZEHEONTQBQIQHCBPQBNUU WUYMURGJJRTRYRCXZWUUHYNFFRPJXZOMFZNAOECN LXSLKSMKPJYOHXGHRJUDMQKAATOZXKSUMAMSJOTQ RFCZPXWMUWMLGRRKUYKAEDJHARLNTVWLGPLXRAWB PIBCDSQFVPCYLWPYIPTMFKXZQNGYHHSWBRNFPXQN YGOQJQOSIGAWXQSSUVGPTVZJUXDMYOEBADSUBROS MTBEDSCQTEXVVZAMHTSDHLKGQLCCCIBNTDBQKVWD JTOOXYZFAFVZHJAZETNEICNVLLTXEKIKRAYQJSPW DNRZTJGVQZFIRZWMAHNANZTFNQCHFMLYZIUWALPD ZMCDKVNUOFKOCZVOGHGYNVAXRZXGDODFILEYCYTO KSDRQEFFBRWUMUEMNHYSZDUBSCQFXIZRRXBUIBZS USVLPWGTRSNLZZEZTUAABEOMMRUPOUQSUOVCSFQJ KDTRKLBRMVHTWQNMOLNQCCHZOWHNMSJCFMNMIPVY YFTJUODYFSGJEEEBDGVFRQAZMFFNOJWEYBFYWPFD HEAKEFWCCHQRQNBMUCUYPHCDHQLYOPXZSQNDLXCP ENUICHQYPSXQHZRGYVBMDUGTURVYNDOWFRSGZDZU LWMDYUFFIMPKZGGVLLEQETBBECNGEVRCTGVRJIXE HZLOMQTHWNOUQCQPTSSUCVXHFPXAJJBQPDDNGRPS NVILWLUFDPVNTQRYBBVVYUYELZTMJKMRDSYOFMMW TYIGBDWLPIRXTTBWQLSYDIKVHVEEIWHWTYZZAIKG DOGANMQDAOYGPITQSYMHMISKSRFCSCMJJIAYLFWP FKDBQPWKMOBRLZCIWIUASJRYBZVCIYKTAWNLEOCU DEMBLUEJRUDHKSKNGOLTWWUDHFLVYYXQJMMFCFWP QLEIUKPVCEOTPODORDWLFJJPUNZTMJPRFLTDZMYZ YGFWWKMZNCXXKQUDGBJRVTQAWIVWIRIMDOOERPFC HSXFGKYKMCCXQHRBMFIAYQFHULYKSFXBYROTRJQF QKRLCNQCLXIFHAKTMDAOIZVWMJFGAPWXRGEGOZUX SXWBMLHBCQDBXEHOMRCTZXXDMSRYJABQLEJEEIKL DREJJTOFZPZWQEFBXYVVHJCHLEXTZBIJGZENCWYY LCNCVJSOIWIIBCBFGHZCPOQEEETKAXDGIINBLYEZ RYBDNPKXYDPRUEFMKZDRQQAPDQLWEGDSOVZTLKSZ SDWVRPBOLBSUPAFQBFKEARCZHLMPOGPJUPNUNVFK TOKDMAOIFEOQKJVHLRYYKVBXIJLTLEGNIPXEYMHP EKSCZPEOQRNZCDEHLQATUNKPTLASYYASSSKSCYPT KPQQPEHQPQLNMHYYCQELUDVWNZASQYWIKJNDCNDQ PEXMAMFYGWIBWVECHGSRXATDWEIAKDSWAYPUDCJI GGEYIZKLKBQWFZUQPOHU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TXSIHNEAYEONNQEAVNGZYCNQVKQDAPSQDZLNKTXO XQOCDAMRFHILWWDSVKNEQWDBDMWMDXJFQSTVOUUL RPUBHPCTYLIQLYAIHBVSVDTGUFMMHXRNHEIEJJWO ZHBGWIEAZZURKBSYYXBQFALBZOZYDUWDOLMHNCTU OTESQRSLEMXIPENEHRHRFXQUMAFOEZWOWTQHFVTO HOKIGFIDJWRFGTVIEGVRATBHRUQJORUKOPRCHGEV TAGUQFBVDOVKYRAJHQLUGRRDEDFFTQLZFMWTXOPC TFXPQJKMBUSHKVSKIIXNSGAZRFLITOXOCNYZTPOC DRMFLRBHNKMXVLCASPJDCBSITDKNSRFDXKXAPDNE PWYXUJEJMWBBVTCZLJFKOECWRLEVNMVDIRKWYQZP RAHRAHEWGBOYDBBRGKYYPMKUBVHDKTSXRBLBOVBR DCREZQBWIPTMROMZGCKKJWMLOPGWPRCQUGLVCIQE FSHTINNQRNCZPEYEVPRTEJGOJBNPCVYATHKCHTLF UNUOBNXGDIFWEPWINVHJHDKRLIBSSHATCVGHFONG QRXLXQTJIOHSUQMDJKTYGTOXUQMJYMKKYJSGTSIY QSXXVWKKJTZUHQOIOGRSZVLZJJZDYZEIABGSYSRO OBCYDNSCLEXHRMAWCFDZYNZWYLVJSGKRFFEBPQXV DJUNUKYXSGYBYVOTDMDPDCVCOOZJHCNEYWIRJKSV SHZYYPODCDHHKJYEZLMPZVGQZEXJEGBVKIESAEOA DUVASBQBXJATGCKJVGUKVIYVGPTYBBWZBKQGIOLH TCBAADNGUQTJGNZUTDSMKJFSIBXOXZJHWOAGRYJT UPRMGJHTEBEKUYEJGOFDNXEEKGBJXUBUJCVAGRGS NBPWBCJHKVLKRSWTFIWBXTTAOJNXGISBRAVPPZFC HEZJSSJMOGSHGCTJSNSITYHJLONVJPRGVJNRRGIM GDBFODTBSXLIJYERWPBQEWGIQJKXMDFSKXYRZTPD KBDZDBTSMQGTUCOWMHVUEPVOJVVOGGFYKZKEXLTN UTOVQYFERMJYPYLDBQYDNWHMSITNNPPJHTTXCUGJ MYJMOVCKERQGCLQDDRWBWBMKHDTDLGIKHDPGYASX JUOCXDJELTWQEQZSNBUACIXRQZHGSOSXBGPDBRRS ROAEFXKZVBSCARYFZQKNPVGGTNKMWRSMQCKAJTRR HWZZZUUSZAWMLNXKSJKNKXKONYYHWWVQQFNMJJRQ OHNOIBXMIHLKBOUYWAOEMVSQWGUURPKINOVSGOHA GXBQUDQTWXRGOFRFNZAJNMCRGIULDMIHMISHQORH AJAEVBTHOSIHPIYHIHQRULHNSGMNMQEMPMQHNNNQ XIWCVLDEVIIQZDRYCDXZYNQWJAOEINXATFGTZAXF NDJHUXECRLYYUFSIYJMMBYFIZRHWUIQTCZTYUVXI YDVLOQMLFHNCGFRMIIEEVZHPCZWTNKCCYAFNFDQE XZMETSQJFYULPHRJTBBARRRNUBGSBZRHOHCVGXHK LYNKENOTIAYIOROVBYKPZVMKLIDWRJCXXXDGEIPA CTOZRUEVXLEQDXYFMQJAPVKKIHPKJOHQKDLALKFR FJQQAJKRSNOZZHFOWDDNGTNFDLTPDELXAKWFIGVR XAQTNMNGIGEEQXENQPTPUFHOFFEDWOCMOOPPNNNZ LGEEWQSRSUZVYTADYEXOFKEHDYEXBIGUQQPWCDWJ WCZYTEJCOUFJJBGWNWHMYDILCRLJPXMSYVDCYTDX YCEVPFGUNGOFFZFPSLBKQRYLABYZFBBGMWMCQFDT RGPCRNDNTSGUVKJCYUYEAVXJNASDOPDPUQESLXNJ YSBBXNBWMWUPBPQFSSQLSZOICHALDBVQNOELZFSG ZSIKDFCZANYNWOCNXKEY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YUCLTECVDCOXCRVBJAGUVMDWKHZBDHPVDQCYVLIC RXXQTNEFMBFILEHYZXLDFFNCGENSBRVVBCLLFSDP THQNAJSQOCROUMXAPELTONFLVXLFSXAZIGYNINMN LSYAVGZCLYPAQFLPKEHVXSBKMDFEJDYAVGSLHOPY NPPMWYSITMJMQBTLWYFWRWDAAOWJGJMGKMFLOYMF TDCUZMAAXPTHJABXSODRBMFOAYMGQQTCTOEYHOVT GVXBJGFYTNTLVJEDXUSRRXFUHGHYJESDRTVSTPKR NZYHMNNNCFEACTKERBKDKZEPJICMODULGQRXNYLG TYCKKAKBIZGJSAEQUWYWOQDIOGSCBEJVVJKGWVKN XIQHVFZEBVNJPNFJVBILUWGMTQQCNMYJRTRVJGBW TKVLRNPXRXHQEVKVDGFULZXKAPKBSCUVVBDCGSMS EZVUOAWTEJKLZPBWIVOYCIUSIZALSCNYKSMYTXIF TAHGIBDUOWWIPDKEWMZLNUQPHUDLYAMKQTJBPRSI JTOQEPCSWTSYKDJFXUHXJVEGQMJHFTCCIKHRTJTA PRPDAVLCAWLPGTJTIBESJVHAVIMKNTDGYKTRZXBH PUPRZUWIKQEIIOUWKLHUMGPYTZLCQOFJUMVYHVPD NQPPEBHPEPBDWBXJFSZVJIPWXWOWFZRSGKXSMOLK MRTBQNKANQULQJULIXKDWIVKRIZLZRBXELEZXGAN KCJHSOIZVRUCKYGRHIEXZFXCDSELWDQAVAXRZZJD LKDEFLGWFZLCBSYVKRHGXMCEFUNZAUZHCDKUISHM GCZSAZGYWJMHIMZPXZYOZDCOLJVFCLDGLZDOZVUX VZYZLBMMSZUYMMSNCBQJTIDXAYUDQZVDWEHBXLJY IYJOARRBZZXYTCFVXVGBUZYWXBZOXZEPJJNHSALM RBTMBWSJAIBWROGZYOQOWTKQDRICSVYBUNQNFVRX FCERWYYDODGTQZLEKHCYSHLAYACEOOKMORWFOOQV JHZHYUEMFLGHGEYXXTPRJYVTHNQGTRGCCOJQSUET VHTPJDIECDBOJSXCRNDOZQVQVUEYHZOKXVJXXHTJ GVVCOVTKVTXQWNWXHAWEIPXVYVAUZXDBIFMLUMVC BCZEMDJBWFKFDRMVBFIZTVCUNVXOYBLAGHICBEQU VPODVVRDUEZKEUDSGZWGBVGOUIPWOVCJREWUYNHN DNVVJGGKGOZAOKPNUNJSOIILQYYHRGELGMMUOTUD MERUPGGIFZOFCZRBWVDKONZXVAEUTNLSWZZLOWHK YPYBRBRLASWKZPJBJGIHYPVFLKYZJBPIXJRPGTPN XPFBTJAOVWRVLGGCMEPZLKJCERIBAOVPFCKOROIL EGIDUWMETTYHADMFOETONMPXNYTZCBOBXDENOKOW VMQUTCZBEXGLISHOYOKEXRRQJIXUVBNZAOCYMVDO OVKMFCLWUEPIEGQWABHUBYTRJRLZVHBRQTQUWOSF FNYRIWJFAGRTNHDKIWBKDYCZINSVHJTPYVOPUZTQ QCHIWLEKCNVIKYMYFKPQHROCAZZGNEYCWYMBYUKA BOOOGSPACDCVVAWHYZCZURJOOZWTQPPUMRUSGVRM FCXKBXYXXNFFDULLQTBXUPQDSHLSZSFSKRYVSGWQ GGKQNSBEXXOZKWSMLXLOMCCTZQXKYUMDUQJDFYAH FORDAFLDARQETIXTLJPQOALTRZOIIRWZIBHHYVTN NGGJAUUYFSDGEPOEDGBGUQYFLDGDLCGAKAYZVZZI CFAJFAZJXLMWVONOXBSRTLEFKYFJKXZUPPPVCNSE ZZEIWOPBZQPWQSDHLKSRBUZMZSKFWYHDBHXGAJLB GSJYXQKXQRTMTSVGOOLOLMFLIHNDHPAKHVYJCIAW RBPGPTYEJWUYRTHXDXHO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RNRZQXUESCTVGHTPVOHPRFQVCDTSSOIYEWBZRMHL YYYIHBPCYYMKNZGFBULNLFPMGFKRWTLOSDZLZHHD KDJPBAENRKSZJHJAPSCYVMPWUURIVLBIMCUTSGCG MXXTNLWFASWHQSYZQEUGJOLHVGOUZSMEQSCWYKJW XIYARHZLBYCGIDOTBCDBSXTMALHBSZYATHYFTWDZ DRSYQNHKSVAHMIBIPPTVGSQANNHVZXFFTLDGYJIM CTJAWRTPSGQPSSBMTKWIUVAMXRAZXJFKOQKVUGID GPWESDCNAOZEMUPJDLQRXMXNOOQOXFCCFCYPDUJQ ZWQESVXSQKYKNNFZDWMNTVMEZYKZXMBOAPHDKMJJ GORLVRKQZVGMWWLFSMQAXNMUBHAAEYCHHBATWBEJ AIATSJTXNEIRISMWAKKIMAIMMOWIDXKIPNEERZFV SJCZVXYOPYRLVOXQBKOEFSJLTCLFJJKKKIZYNTWH VUDFSNXJSMRTOPISOLOAQQTWEWNEZWMICBJBPALI CHRNLRUZVNEXRZTWSCNLVRAKYWMIHTWCZLNGWLBF CDJBDGQDBUEEPOWGOQCOANYKOFKIYLEIJPMJUKLZ GBUZTVNTWONAVLXWDVIJGOWVHVHRVMSODMGDZWEO CWBMPRTHOEKMVISWVWIDVJYMVESJKNOXDCEZDLUN PEPXPMPOAZXULGWDJQOZFMCSKBOPJIMJVEGIUWOU UTVCFWNHIKDNXESBCOMAUQDUWARYVOQTVLXCDTDM PZMFZPZTZNPJSLNIRCKUNZWNLFYFEQIYOUGGAIHB OLFKKGFFYBOXMPEYPEIJQDTAUMVJJOKROHYBPZPG TGUNCSFCBOTONXQSZSPYZAGPEJNJXTEQJCVFBWWH CMYEDGSVKWUZWWPBGLVVTKXYHMHXXIHBSNYKMCYY UFMVOKZBVYDYOHNOYRMLTZBGBUHXHKTRSIBVRWIS UWPGBTHJLVIPTXDBDUCLVWSLJFMITLKOAYOUAHDW ARGDZQBVOMKBGCQSREVRHXBYNCHCPGEUVUOHAJPC UMHGSTYXPSFNJRVQDRPZIYOMBWQHKWJNDYMINFGN ZXONWPIWKSWOPEHPFIRVLGRJZZPYJWANVSSPYWGZ FPVKHGKNFOSDDJKEZEKHFKJJIDEJUJIIJVXDLYLM ANCLOPEJRVLXECTYZBCPGFPOUXQDLAFTAKKKWKGK VUFCMMTUKGDWTGDOQGPVUIQWUZESDAOSFNXKMNXU UYBBYDGNBKPKTGFZCZRXJUYVQMIKEBIJTZLDPVPM WCNPTCBJTUQNNDWUXYGWGHKIFERPOKFCBRFBCDPY KOTNCYMIWWYFGSLLVMXJISLPOMRGPLTEUJDLHUCV DPFJTKSXEXHKHZPSLWJNXSKQDXKQOZBXNSCWOJAU VMSTZWZHLRKJKQJAURUMJEJZIHIGCNIJRGNQKWDT EDWEYLJFMACEQWQFRQDVQYQRXOITVOHOUWWCDSPF SBFGHQQKASECMOQJJUJTSWLRNXWFRJWHNZACFLJD CLOUXDOGTPGAXPGDDSDXMBELXZXQUINQJQRRNQDO HCHRRDKNMSUQSVNQZVYJWHBCILOVPYXXWNCCGLLX BARBYUIZCRTDWBOPLXTIDGXALFGERFLHLRUPVQDA ZHZMWJZDZVWEAOVHWEVQDJBVXJTXOKWRFPJRSOAK WGHUYHBROPQYWHEZLUZKZXEGNAMBPGFHXKKFAXTP JFJLHXDYMGYAQTFDQDVNHYELVGVIIWHLZXDGCVDD ZXXJHPXYSZDJDDOVYMLPFEGYLKCTYZKQTGKLIGKE QOAJOCOPNDYHBHOVCHNPJNIBWJREOUPRLAHUMOLO WDWMNLGIJJVPXCDLNLWJRHCSGCDOSTFQGRDJOJEF RIQQJSAJFWFLFDTYMCSV
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      XLRCYIRMSXEKMDMJWFRJJJEMQKTUQNXEHOUXYZPX VIZGLOULMHWZHWJNJHABGUJSJULBSQNHRIHACCHG WNVSTNDYORFRJWGIXUDWYFHLGEHYDGXORTCXSCWP DBFMTPTEMJPEEKSLUVTPKVFQERMEOUEATWQPTQEH LVMLGSOUMLPDEDJXVVMEDVVAIXUYVFQFGHCBQAVG JNRTYDBZYYBQRURJLZVXSQAMTZDEUBPEEBCTXWAD FDKLWHTAGBIJFLAUKQUUMRYSSTYLWZDXROCZHAFW TXSFFZYIIYBGYJDJQEAWIXMHNXMCJBRKJOMGXGIF FZZNFPMBJHIVMPPDEPSVWUFAQKYWIHWBKTNQMWHR ZIGQHAJHDJOXDAEXNZPBDCCMTJRXKYDZKUHSVUEA RROLRRWDPMJQQAIKTWYEDZPFQRVOAQMJPGTPCTMR BKABSQATXCYGTFLIMWHPIVHRFSQRYXMPZFFVSHQN GHYFOOQGWHEJHUSTYXBSPCWXYNJSLBSRLHALNDKT BCOBYDEDAXJJPOPKBDKUNEPLWXDZGEWZWCNEWPHA YUYYPWXBGMBSNAJRCKJESIVPXMYIQZFACPCYPTCD TVXYIOSUYLDBQKPYCKMWMEGDPFHAHRMAPBNHVYSM BVQDSRAISNWERDWIJRCQTWAXZTGYJVECNKHXXAKC LBXMMCQODZKFGWLSTVIPTMOZWADTJICSRFJVNXLU TGCGBFXPAYCIORFYEWOHVJTNJOBWDYBUAOQTXAWC IDEDJDEDRTCLNULMYASYIMOUOJLDREWIUZPHTXZN YZYAKMLYTGLREBPXRTUTNWGWVIBTAKJVEGVMDBNE ENUHGEUMBMHGGPDQXRALNNKQFICXOTUGRLZPCIDB KSKFWNXWTXLKPRSLUAVGCILUXCENLFFGEZAKCFBQ SPVJGNPZVRAHGVJKYUFBQENNIZXKUCIJAYEYKNAC CFDBXFEYMWDMGEAMFYTZXGGGJNVAKCBMPADZBGAC THYCNJLJGFCPENWVXBQGVELXTCAEXPDCEFLUFZSH BZFGEWZGSHAYUIXRZHRBQTOTLSPMHGMNRIHKBTJO FPWMRLCXRMMQBFXSAYTWNNQXRVRQPTIYTCSWJIVJ ZXZPEBYYJNGBTZIFCIDOXDNSMTVIKNIMKQLEHDDB PFWQNNZKVHCJBQWATJHGDKQRFVUUOSITWEWGXHIS HMCEVZYCJJZHGZXXLGULFHJSQPLAXAZEAANYIODA WTOUKOZGZOYNAOQRPYWKQZDZJPNBGNIJCWJNMTNO HKLCTJIPFOVNYXQCEYMGSRSATSWUFTCZXLXOFKRS ISMUWEUFJQXLQYXOZRKPLCYPVFLLVGOVIBDLAYOJ HUOBOJPZSOTEJYXHISNCZDVLXFJHXHAHFANHUJSO ZIKAKOMUGCIGDNALQFOOHKJAZJSVIGXODOSNQLPP DDQHBBVMCNPFELUMWZZNWKKIKVUYLBSNFIKJUMQU VCYQKZDZQZVUFUMJAOCRQFRWAVRTGKJACEJZGURN XCFXYEEMKPBUDIDFALDCGGXJZXHGJYQPJFSLSARE AMENHDHNPCCQQMKUHVHWYXQOUNQOEHUKAROCUWRM BNYAUKYLNSNUQVMRGNXRUSPGRCNZAZFYWTUEDXKP IPCPOQUDLIXGKBFJZKICQLKRBTYUNCOGTZNTZPVM KOVHKAMLNPTZZAQBTMWZFPDDVSRBIZZVQSWSCSLY BRENAMEQBJDMEZBQNCTJIURLHMJPHIXXEDRCIREW FVWLZCICOXQRGXNGAXOAYSOLXFNOVPDKDVNFFGPB XLOZRMKCJWJEXLBQZYATDMNQDNTKRJBABXJJWLBN WKDJRBNOKBCEOVJGTUPLGZHXWXRKLCYOKWXQSJXO EDTFPCDWPHTRCEQZERZN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YRUBGNDYAEBSHTWSWKABARAVGKZVSBGAQUZGYIUU LIYNOKWLPPIEGJKDUFTLREPZMARRGQZELZKRJJUD BQOVDGSZLQTIYXUMDRECPVBZBBYREHMWGFGXVFCL BVMIATTTAZGDAVKHFZWIYJPRTPGKWQLVACBDOOYS VOECPVCULDIDKYMISGKNWFWWWBDJCSPUUGFEPPBN UOYMNAJSCDKANIIXLIQUFXQJKRIBGEDDCFKNVWGE AXSUEQFWKCCEQCMKXEAYPISANHEDXVIFACZPPQSP YLWSOYAHSUUBLEUMPUVLCLSUCOTAVWJTQLFFDRKT CTELJNGUDFYCIQNOTFYYHSMVATGOLJAMAQAFMAHC RBYPQXDAZLRMKYZMTDFRFGVNSWOBONCREUTEUVQG JICZMYEZXFXCMKIHMLXTFZVMGWSFOYDZDTONHZLJ XLDNOGYVAHTIZZFVHJSQBCHCMGPDWAMSJEZOXBAV OWCKASMDGORTZZTXIJMKWHTGCNPWEMCJGSSQMBMC FHWRGDWABVBBDLMDUBUIRUGMHOUXUNMXEXXFMJAR WULUKRPUOLOPTHQRMAPMEUVBNWHRUXVYBHMLWSJT AZTURAFNUZODJDJQUZYOYWYQRLMYIAGBFZQNEHMM SSWSZGTPHLTBYCDUODDAMESDRRNYPPRQIRJBQIPD ADTHGVERSHDVPUMFORTBRAXBKWVDOKZHLHBWZJYE ISNSHVGKTMRWMRALKURBBHLUAZKBPSRMQBIVTGEM QRHAWJPJUUKSTIWBIMBZTCXOUHDSJSWDXVWKTWBH NCBBTHYNPUHVLTCJXLRASOZXGYRDAMWLOSIRARJV WUGLRGCIYBCKFZYXUTQZEKMHVSCDJATMFVSUOTAP VCZNGIXGWEBVTBJUKLYPSFASIUBMKKLRURKXKENY ZGBNKOYYRLCFBTIYNHNANFJRWKADIPBLWVYDDWOZ KJTWXDLEVBEKCWWFEXRGWSJKQQYCEKNAJANOSDVF PKWQHCGAQTVODXRSVIFVLCWESVVFNVKOAYGOLGVS VXBHKYKWPZZAFGCEYQXMOPJSRBPOLRWRNCBVRYQG NMNMAWHNDESBFIJSEABHOIPPAFDTTRNPSAFFXDJD NHEAOKPKSEPKDXNMEIXAFBMJZZTQSMOLBTENPGES QSNBMTRPXJSLHBISMCDRMYIWSBEGXZTCFGSWQGGU VIDRAAHQBBMKCFQLAWKEMYICMOTFIDTDEZFCNHRN QRUGIAOCMHFIHDSPGSTCVPSWNEDYYQLQMJOXYZAO ONQNSZXICZOMPIWOLJRAYCDWLRKDBVXJKQIHYNVV SFHGPQNHLYNWPGLAFNUDOMTSZSFBFUAUAOPWLPCI LZTRUHTFYOFOUNEEXZWNRINRAVWOETKOJEDVTSPD DLJHATBANFFZLCEPYJUDJCJABHZCSYJKBSPYKHCX TAGZYQJJBJALLQQIFGWCOQLKBRWABKYYENWXEAGY WOFNQSGRTCWARXZALEZOJWBXCOBQZJGKQXWCZNAR QGMLCJVRBOGXIXNFNUPPOWUOQQGOITFHZDJXOFUQ SFCXPCMAYZJIYALVYXKQIUAVRZLVNNYXVAJCVDPP OBONRNDSMBOLGDSCEYGZJPVYNHSOULQJIUBGGVOM KGIREMHWXAXAFVGIIZZJJKFPPIMCYZREYQJBYFYI DUACUOAMNJVYFQLULZEKNYQPCRUYHTJWQLSNXJDG PKNJODFMERSDRNOUHLBHKEJJZPDBDTNOZPWMDVIG DMZUBHHTEIJRULMNIZXAWTCENTZBZUWZNUNKACNS CCYXGRFGNRWSFDWRJJAWSOVEBSSNWZSCMFSTVULI BLIPOQIZSJNRDJYTVMLYZLRVVIDFESJGEAZPDSSK STNGXNCYUFLXQEBNRJAT
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EBOTJUZSLTDRZFFBWMFNMCPZNUWZNZXCXNYCTACJ LXIZZRKLJDHKSWRZBGBTXFMTLKTPPQFHIVHONTRS GNXJEHTWEYPXZAQBNEGMKGGGMZIAPOFPNEUHUSTO NMJXVCWZIVAQDGZUIGDFIIQUICZFHOILYZECXMVB DIMVMNGMOBWLSPFCWULWKMRBTARJNOAYOXXIAJGX HXGPHYHLJWJBWKHRURIFSVZGVDUSEWLPVCZRNOZN IXLFPOMPTTFDZAVHEUPZXEUAGWJSNHKBNHWFSXYQ ADUCKJSQBWXBASBTLYETULXUEVSIRHAJAKURVQMS HRKZFJUUTXENYPQQEOTZOUEYJXQCTVUVBWSMYQWC MZZYMDAPEKXJHDCDVOTZJANOSEDDIMOHWVIDVRZA UOAHHMLFHQTDTDVVBVKJGSIBQZWNGTWYGGNKQMGN JROGQXCUTQNBWTLPYJGNVTGMFWCWEALPBFSSIFIU CNHGWJOJMOMFFRUHXDCKKBCXVYURFHHQRYBDXKYV LCZUTVAWKDFONTSHNHOLZJKLFNLFSHNMBIYHLYXC DPCRBHDGAOJAEUUKSWVNBGWSUVRSAOOZVCGWSIJH HUVKGQADLRZIOGCCVPQUEMHCQDBLBJLFSRGVMQQU BGGRYWCFOYCSGTMYWFRCNZDWMMQUGPLQJEMKGPIM PEDUXJCEVNQSXHATYNYKLRBKYIPSFQVUGRHZXPXH YDZHTWYNYVVZTDQHXOQOTLZKGWFBQNZBKIBNSZNE CHOSVNFKRLITGRUXPKSBJZZWDQBORZXDYOEKQSQT QORGACDLTPSKKTINPTKTDUSYGFFOBXFTPDBNRJST WBWXPBYBZWYEVFFQQTAPPAVSOADLNILVUKJWCEVP DLIBRORIOJNLFOSUXOVWMQJCJRIUJKYDYAMWLAHT TCIKAFYADYSGTZNFEELAGXBGJIPUWKQFGXOTJUUX UIWGVXNDOVBGUAAKOSIBTWSMZQRXGRSPYEMPLGVF BQGLMKGAIPWCQBKWGQCPWFCQYVDLQIEARRIFMKEE MTAKUPDHBOMSOOHFOYFAWFEKNYCJQBZFDESPZZZP WWDPHAXQKSIIYJGPRXHLWIJMWJTEDEISKMINKWCY JRRMIDTSZSQAARLODWOYXTFMCKDDFFSHSJMDOVGM GLNEVWZXZQAEEWMJUMJWXNDKNJHMKHOOIRTNWKLV DEWMCUPQCMZRYVWSQKHCYWLPRDQSONFMAVQRIKYR STZFKYUFYOQTHOZPKHPPYDGKSKKZCPKVFDYFCGCE JDLUXEBIUTNODKBQNUESWBEDJMXGLCYFRGOGJJBL OLWWHHBWWISRCAUKJPEVQYTMEPDOGXUEPSISCLNH ESBADXZRRVUWEJRHSHTBWLWLLIOZTAEQOVMFTVCH FZLFYUXGETOIMRJVBEOTRRJENCXLYAKJAKVVQQNH JMLXYWFOKWXEXMMXNVJARAWSAKDXNCISEUWGVXXU MJBQVNCGCSYKOQGCWGGWDJFEVBJKRCVJGBLBFUGU FRSAMKCXKJTWVIKHNXEYONHAHQPBXPNXVTWRGRUW ZGRKYRJRBJXWGHZNKXPXMPLTHECOXXLJQVAKWLSQ ZZWKVYQRVWEEVYIGXHMQUTMSNCBETQDZHUWOOJWR ZGJCXKIMXOCGMHEZBCTPERPAGCRFQBKSQHMOQTMO LXOZHPSJALBFFSEOGVFSFEPWVHFTLNJCTRCWGDGQ NMTMOTDSVMMDFIRDLABZUFGNCZOGGQCAWSLJGXWV VPMFKSYWCWCCLLDQXQADLQLBOLKBEKETUEFSOZJN YVSZNXFCIHZSVPHCITTBUBTHGGYKMZCPUMIMVMDC AIGJPEIUWYRFCHTYKRTGZEGXEHPYJMTAKTNTAWGI CHAFCVRQWDTYWHOIAFWF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      VLVHRABHPUEWYPJSWRZZOTUXWKNQEYMYLDIICOZT IDAJBLWBQTRKDQXBOBJYWCZIGIUVZLODKUOSUKHE KQISVGKZYLOHKNMQBHUDMOZDQCOEPRSHKNWNVVCN NPHBLMBIGEIGRORSPFWDXWDRGKIMTOIMPOPNOXLU HKNCXOJNWFUFMLLHHEEFSLAKXKVRMTKHDLTPCXLK TWTELHNQGFSARNISFXQEDWADFJZEWTTEYTUKZDUB LPFOWAGDIGLOHGXWHUPBWTUFJYZXXISLARDKVDOM QOEEQFWQDCVWEGNXPAFEFVQNUSJKHRKZDALSBDXN JSXFFMDTWZEAZDCEMOMQZQGFHRKFQBWHIEIVUMWJ LJDDXBZGRSSXSXXMOTZRVCMWSNWBBYPJJMDXWWIG QYPZPUHUYWAAELLQDVJFXSXLHQAAFUZMZJAVGYHK XQLNQXFNNFGXWSQKLDBJCAQEYDODTOBVSESIIXLN FVXZSEZAHBMUKGSUQFJVDJOMGLFMJMZAODIZGOIC ESCAJOQFDLMWPLDUXWVOOJMLTNRDLFWTKHWQOMGV JVMFBLNEHBZCDWTWASIYFPSTMUKGXEUAXWZIACRJ QTKKWJSFKNZBKNNLKSTZUBSSDTFWHQDROUZVRRLK AOQIFKRJYUJEHCLAYUSUNZFLVFGEOVHKPAIGOHRJ BTAZNDMEFFYLJFXIUYKJQPMNKUVCMCZSRDIUHEWB WKYRAUQTXLWIPDVNEWJISEAYFNESKIUZNHIAXMFG ICKPDWVBFLQCCOCZKXXXTVRPIZUFNPIILYEHLYNG RMMNOUZHWTXNRJUXSJVVHEBYKELIZMSYXDMOCOSH AEVBDEDLGJAMJKDVGADBNTHKXIRIXDDWDZKYFJPK MJPFJKONDQMFCEAWBGDDCSKZKYXAJVSYYZDABDYG UJUJUAPCLRKOXXPELDGOVGJSXTSOXAWTTTIFIENC FQHURCLLOHSARJASZKBEAMQRSLMLKQJEIULTJFBY YPKZFHBHZGYOYXLGVMNIJOMXBHSUIJJYEHVEIUZT OELHQGIZQLEIXQMRAIGMWKFBILNWJVCJUGRPUNNJ UWSNXREPBQZGSBKOAJVVWQQPGOFDSINSPOWLASHR PATRRGGSCPBHCEEEHNALOZEMJVZQWZIMVNHVREXP XKPMWEOBJIVLVGGBHABRTKIBIULMPKWENLUBFTLK IIVZDJQXDEBUSPCHYJSKRVNIWXZTAYMVHLMFEPPQ ZGHMSPRPFREQPHGMMVWZAAZBQHTYSGGULUGIKJFF AKDICLLIVQBCGANTKQCFEUSLEVXAXSTAKUIFKEVG XKGIIQMZMESPCWQDEGMYIGODJLCHPEADBPUTGCVW RKTZVKHVTMDODFGBTVJHKMCXTHPBHHPEKQPTGVIO AMOYIYZKNDOIUIUMUNPZWIXOHDUSADMDYTVWCAAT UXFKMGTPIMWWDWLDWPPBCTMBXDTSBTBHOSLRRLWC GCSGBSNFXKNKDUSNAKPGFPWURQZRPRSPOBOLHSVS JSGKSWTNFWMICQEVMPQTGIBZQKFQSLSGEZHPSFTO QCWEUMCOVMRJYWHYCLXNCDGBTBLBILXIONBTKLLD TOFANBSUSPESVXDZSHZDFNLMATDKXRCXUVAXEKJQ MSLQVPVQNSTEYHDINKOOXGUWSDMPDHVNLZWTFNUX PSWSRSFGLOZXFDWQUKQMULQGGEQHLDAAASSFNMLX CGBGBKBNHKXMKYJONMNXZJATXMXQQHFDMELKJZRG MDSQGGFLVSZJXWYKRDYFLIQUGSODEIVHZWOUVFWY KOGRJRVWLHZRFQCSXVEWTYFIOEAVHZZVEQWCHIEJ ETSGJMNJBNVCJPFUHZWZIEABVOSIEFKCQIJCBAUJ KAOWKKNASWNAILBMPZOY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NCPJKGCCMUMGMHZPACAAPRPZCVWMWMOFCVCMRNVR SKITJDIHMEWCTDACCTFYSYBUTVCJRNAACXYZZLHC WVRFOOVZNDVCTKLLXIINZDJWXHAWWPYHTUPOCQUO YFDNJEWUKYQVXTSPMMFKETRJKADNZZVHJNQSHAMV RAAQBTFBPUFCYFFODNWMWZNORICPHEVHQMVYZYHU YMDCJWXZQMCWBLYZNZBAUOGSYHDLAXULSUGOHXWI RINXQYNRBWAZEIHXPECZEOCDEZPLRECUQCZEATUN QHFPGLFSGTCLYQGBYWMOAYUELGBEKYPNWKHGOCWJ FSBCFVZIVHSSFBDEMXUHLJMPXSTPZSBIWKVQRKAU APNPJANMWSODPMISAEDLCPPZFHUWLLZHEDSSZSXS VTKHGDTRQDUDWRUJLGIXBMPPACROCHARZNFREXEG TAXVJRBMCZBFXTVXWSAZWNNTIMWQTXMHKDBSKWDC LABNCRCVGRYUVKGWRAFPGZSJYZXOGAFFISKNJSJG GPOSRMJHLTOVQHINBSLYMNKSKNILCSDRVXAYPOHS PGWUAOBQWGZDNDCKEAQKCEZLWVPSFCPYIEPZESZM QYGVHTEKIBMBNKRPCGIVLZEVNBLRRMPQMXWGKYWO JTXPSITNVQAQBSSITCTHLVGYSOOMHXDTNIODMACK EZUOSQFJSEGQPHTFATTDOABTXRPWUYHGWVVGLTXA ZQLJSGNIANONNPTVELRIOEFLHPISIJZRZERHQXZK NXKQVJGVYHOUAGVIEKADGOLPFHCUZKTPELKBYHFE ABDLRRETLGVSRTLGWOVGUJPBELZEETDKXMSCSNLY PVXGEAXZPZTBRDUEQVHLEXYQVUCOLDPCMHFGNRND XREBIEGLOIPWQQGCXMTJIKGJSZJMVTOZIURLFLEN BHSVGDCYRFYYXGWDNNTWKEURLUQLNNPZJVUPATGT NDLAOYMVNLEAMHSQNEKRNIGDFBJKLZKUAMVXQXVC ZFICHXKHTMUEEWMZRLVXTWLDAHJZGJOSIMODIUXA DJZQZYWRCHLKGWXMQUAFOSQUFIKPYAFGYSAGDXDN EBRAERAAVRCMKMAROVWESOFLLFBGTALKJPXURSAY HKAGTTUZEWWEKNHAGAYXPFZXXZXYDBEIXWFFSIUM PYZYSBISJYSPTXSHQHXLVFTXEYNXRAPEMYAXNUFK ZWPMSVDGISCGBRTOHJPJNGFUCUYGGYVRGFMQGSUJ ELXEJGKOXCLVECSTKQLMETIZRJEJSFCLNDOKQRHX DYDUZOBLLVNJVGHQCCCWIOSNENVKSDGDMFJLZVIV VYSOOSJHKYWYBDLBZEXOUDHHFUUNABVKULIYSFQL TDPPIUKUAYKPAVFDERVXRCFBCBFTONOKYUKEPTCN DHABUOTLEKIRTSVJQJYLFJPJUGPWTCKRWBILTFRE NPXOIFWHAMDXDNZZMYRHGNHFQXGCYNNEACMEDYQG SUIHOCWPBATMTERPSFQXLNLTCSRJMMNTHSFTFAXS HKUOYJVTEKNEYRBRSUDGHLWIKYTUYQARNKSUJYCF GWSIIADQVGWFOLWPWCTMFSVMGGYVVFXSVVBNBUBZ OUOCCNKDERBELCLUGVHVLQJQOKAEBNCXEHJQMSTH RSABHLOPFRBHXLELUNSDMAXFVHQRGZVZJUZPUAJA ZWKPGWCBOTARVGAJNTUFMXNVPURESYRYOQOYHTVY BEITSHGWDAGYNRXGPAIWHBIDRPOQQEEOMDAKRHRS NHVZMHDUFXITHQLKWGBQEBIDBQIGMKENOITSFEBF CAWDCJMQZQHUCOZZJSGSBVSTZWZSKDYTIQDKDBEO APKURVYTHJFHZKXFLQPZKFXDDIPASVJHXXEMFFBG IXTTBJSTDYJYJSYOVETH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KJCNHOBKMMUCZYPQSYFEQADLYQZFGCXITQPOPCBI MBTPWMVPOAUCTNAXJZFXHUVLSNHPFDEXAZBEVSTN EFEINRCKDZBVTVCQVASNKCFMAIQVIJIWRWQHGFRI FEUNTTDRITMACNXNCNNYLFJYFWQDMTMUGUTPPEOX WONZJCVRQDXFBGJFFFLVVNULJUUWCKUYKHDVKQLA WTAVUUGLPLLWDNCCGTIMSMMIAXBSZJCMWCTVXIMH QRDPYHEBOFRJYKAZXWDTTDVDKBMHSSEWWUSHCVPJ EBBVLJYVMWYQXFPSXZOVPSDYASGMISFUGVSKNREA PWDKRCKMJIJAVFRXYJKEIZHERWBUIVGMOZWLGQKX YILXEJDSUMILESXTMALPNHRBANFBOOLWRCSNGSIL FAIMLHWYZZQBTGAIOGPBTXPQTPPJMOQQSQRJNMZS HQFTGYJAHWJGMTNEGWUSFYOHMDDYPDEWMCEUGAMY BOLCHQEUGRHUSFUHCUJDANYBRPSGVLQSIWWOAIBU TOKPKDLAULCWJSIACLJFLJIHLQRTGBZZYWOFLDQD CASABYZSKVUWSGTIBJMJMDXGSGQJBVLHYHTQSHEO GPPRDWMDSYUHTRUSCRHCNISJSJDNUILSHZYRRQIV WZQKIXOISHJHLBQIRGTKLXEFVTNEHWINQFWUYFQX HQEQSWTJCJCGPHOIHCSCTZUAAUCNLPYZDDBXXAOH KNFYTMVQZRUTBTFWEPWBRKJZNXQMCOXKSZPTTZJB FZGQAUYVTYEUPJRXECFYHXTGLJDNPFWCPFBXAKBA YEHBPITLAZSRZJXKYBONHDCNXRBYGIFHZDUAZJTB NGRSZWYYQNBWRCUXAPFMAWHJVRTEIHRJWNDVCCKP UDZCTTBEZYBUXYLVJFSQGNEQLLPQLQAKMNKFSKDU PXYOWGAMIQJBAQTZHRPKMZHRAOGDCMGEPUPSPJYV NSBNAJMAMZPXVYKHDPWIYDCPOZDGZZOGUXJAZOIC LPQLIYZTUNEKMZLDLSTPBPVZWMYJFEZEZXASCTLL CVNGOJLRXHRXTKKDMQKIDUACEPKVMDBVNMZZJBPS BJRPYZEQZEOCHMYWEKCHQKSIJJBMQAQVUPUFITBZ BRLTEUPNBBQSOAXXGVLYDTGJXWZFLSRHLPCWTBZW PTFGISJRRZFRSMHAZDCZEUWSTHTOQABDKQDSJFCI AMNNBZWAXRZMXXXEIMIKJZOEQQOBUUQPSRUNJYAK DCYZWQPFYAMIHYSEWWEEBRZMGZGHIRXKHBJAAJRZ BPVYJSMUMHUIIOBZTHTPFPDZXIYCRVLMJOHGZZWI COYNXAENFQFDGOMMALOANDFIEPVWOKSWHAKTQOVH LSJZDPLTOHVRNLGKNWMURARJGKQVCPFDKXPVFOET ALZFQSZDZIUCOZSZUKIUIUGDKKJFRRALWLNQOBRF VTLSKLAAVOBAAALMWMGKUPWVGLGDWUUJSFIDSMDU QNHLNDVRGLIWSVNJXPAFMXFWQDVCCBVQSTQEDPGW VJWACDTCLTSQRVOOVQUMHKVVSSVRBPLADSSGEUHT VAGNAGHTYVRTJPFYQSFQZLAXDNPNXYOUPOMAFWTT EPASWEOAGZRQBXBCDFVBDWTIYKKMTJTGGVENUJPH YXBXFFACYHWFJDZWFRQEBIKNPVBDHHHWATOQGNOJ FAKHDKUILDOKSXDHTPYJFRLGVRKYBTAQXQKFZELQ TANMXVHAXIALTAQASAEEQCBZCDOMLGYGQMYOIWVZ WTWVVHASVVIGGFRPRVBUOXKEVRCMGHXXQYNKPRXX PMESYTPCKMBAJNBFALGGYYJAXRTUNAMKLTRDAFWV XRCFJKKMPOUBHBFHZDLGANRZDWZBFSGTEWRZNNZD SNURJGKYNTTCMWHXIASY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NKDIROOZXBIQNPLTDTQWTZULMHMIOQKYSXPMGPPY UPTBABEIKIABOECAXJTEUDNOBEJPWGLJDATXBTMZ DOYORTKPUDLXAQUYVKDZBRGADGWIYCIKSJXGSBWZ ZHSDCLFXKYQWRKVLTRDGRMUXYGNTWTWORKJQZILI INKNTTDNQJZPWXLARNAEPZRRKPPRHEXPXUKCGHFL SWSOGWDJJJIDHVEBUYDSEVHOICVBCWUCLBQALNZG ASVQIHADXRGPYCOYJYRHJYVQEQXPQAEWXKVXPEYK RWIFWHCKKGZQSSHRGPJFXAHHHALMQLSEYIPGAJHN LUJWRSVSPFLCHCLHTDOGDPXAVTHTQFWCYWDXYDXO XVWKMCXMNNMFBPLXAFKNHGFBMMRSUGPIPVVSWCZX WYEZPJRNRIRAOSOHCXPWIDWNLHXGIWKDCJVVGUFN DDMNNFTBTEQMXTTWBVRSGHBXICWFXGBHIFOQUCKX WVCINSDEZLCFTLGBQSQNKEJYNCNJVORQGQTEBGKL BXTFJJZMDSHRFIADXNOWZFTBHXAUIYKRZQEQCNFT XUGHYWJZARYQOEMGXJOEGGXNXXMQWTCQWESUAKFI EIFLNXLDFOBKZNUAOJAACDNJNGIXOZVMIZOQEJRI KJTRRWJKKAKUZNGSONBRFQVEXXOAENHISCYLPVTF FXQNTNGETVCQWRVGEQRBMSQWYVXRJLNAQOVWZXTL RPARNQSKWOZRJOEZSZBJWCJCVCPGLOISQLJRPCNL WIOJWNSIEBHBPLWFUIVQIOAENIXCDRSFFWPZSEJT HJPSZLOCKUEOJROEBHNYQFEWDKXFXSRVDNFEPVMM XJMTUEYCVYBWFHUCMQULHIMYEKJQBNEJKWVTMHPC KCYVOGADVPLAGKRNYNEXWCAGPPBKJOHULHZBAFXQ WMJMEPXTTWHKMWVWSFYPZJRYPSSMUMSPTSHRDPLY LTTDSVHTZTPPXWOCAYYCMWNGEBEVJVQJZEDUMERI OXBNQCAETQMLOUFYLYOVRJGTSIIMHTIPAMOUTWLP YZCQWSEGMOIIXNZUFROYKQRTQXHIBJEJIHQRVJTH QBIASMFGIRQOQRLSMGPIUMZCSDHKUZOIYXNAILOJ MEILOSTKKFNPNXPJHUUFJVQZKAZKGIVZSKHGVICW BZZKIRUWFZUBWIVBGOUNMWQYBVPUUUFIUPGCMECM WYMEUUREBSZGEGWUDJVCZOILSKYADHCLBQGBMYKB JILMQBTTWGHPMTFQXJQKNPLBHUYFIUXBVEZQFVVI IQTHLOFJOQCYRQICCPZBBKTQKFNPISRNLVJJGMDC ZXQHRLMXDVBVOSSTYRBWUMDGQMEZPBOQWSEBQCPS ZYSKGBZJQLFJQZYIAVPJMWLJWNPNXKTUUBBOHUWF SJSPCZSWGJXWZFADADPXRAKXFUYUKMWQWKQPZOKE QSOTUJGICLCAPPYUNJCKSULYVABIOZDIIWQWIMAB WUIYHFVVVGPFYUXLUDNMNLNSXLVINNWRMRADLFCE RCDPBDYUQBDOUSIHFLMMGIAPYRRODPHXLQTKSMHR THAYPRKBMUKAJMNVFMGPQDZOJCBKTGMNINZGBIQB MRYCSUTHBZAIITNTBGTXUUKCJFMUHBSXDRGBWJRI XPKUZHKAIGSDEVRFXZDCZBVGIXFRYDLXQCSIVYHW LNZKHAMXWFRUWNFEDWOSVFFKCRMGCKQAGCTHGVTT OLOSDLKXXIPHZPCXDTKEVBNMTGWDKXHOKNPXTHEK BFFJKKMFELHZGZLMHKXBWIMAWGVTWZJFTMMZZUCC KFAXZNYBJPEKTRXDYCBZKLFDEVXNRIKPLVKWUBKM MURZJCOSQIUJUGQOVPYDTREIAUOVAIBIWSNNTSZW PHPCPJKFMUABBXNAYZVM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FDCPMRTNZRTIFNIFTKIGQWPYENFSIXKYQBOLNUDY ZOKQWQRFSSVOTAYAATFSAQCNRPZDELXZYEBFIGMM GWBAWLMRNJGPCWWHCLLPDXFRREABXWKKDAKHGZFU PKHMIPEQNFFBIAZHNVOFERDLSVGILQCQXVQUISXY ZKCWXKOANGEBUQJGNIRPCPWRSIAHAZMONPRRBPQI EAQKFQFCKNYIQCRMIRDFKKGMGFJUSLVDIPYIFKXF NCZAGZIXIDPICFZVYSOAUJINNNFOGPLUGFSLXWSC VUVAMQRBHNWJVFHAEMZWSGVKUTMMCJHHSTBUWCIJ KTGWSAZCVWHCHWIYTNJMSQLTAEJOEHWEPLTHGIOM NZMRWZJAJKHBRZMWRZYKIERSBZHKHORJABIXICYA LKBYFBVSXHFYWIWGRAKSJMXOZTWJOYGXOEVVYYHW KNRSCOVXUGZQWNUSTRRXMCALJDNVBJQERXGSBXUW FXSEOKATKZCBLTGGYZEYXSRQVNSDXLRGCTYIUTBV BVXSGLLFTUZMNHZBUBVTVPQRHHATRHULSMYMTRIJ XKAKICTEXGQZEITLQWJXWDIYVYQMMNCHDAROKVCL IHBMIZUYJJKZEEBZLKHTMVCYCVGFLCOXIZZOUULY WQWKQFILLNSUKGOICCEDJHAHWQZXYOLVKWTNUNFM QWXLMPESDLSPLVXTZPNGJKTCTCHVXXJRSSBIESDX EJVEZWXEKBQSKCHVEHOJZSUCIPWHTGWAWAVVNPSO MYDFJRMLLZUMXWYILNTKGNKPEFQFFYLZFAONRDQH GVRPSQDNYKMRGHZRIYCIXBPVRIBELXDIZPRGZBBJ MUVQGZMQFPOXHNGUCXLEYWYLEHDHZXKJLCFOKLJZ FWVGXDUEFGOMLDZOXKMHJIAEXXRDULQNUSIAMACC ARWUQACHFUBDKYAXAFQGEBQCBPYZPFJSJZKVNZWR VLHNNEERBIDIHGQBTISNBZHDPYXYOPRHEEOYXDVQ VYLZHAAAKCXGAZKEVOOWOCMWHIHGAEXIRDAUHCMO RCOVNDBOKZAIGOJICGJBQDDYLSWPNMZGVEPZTGPW VNJQWHHSVYPBVWCYTURQTDZYFFSVARNPUYUXMYWK QKTVNDUBMQBDYKYONCTMKFHRCJHFGJTMZIKEEOVZ WMRSUXTTUKTUXVLZOJTUYJVINWIUHTAKYUHHDAXV KEFPHIODNRCDJMYYHRAOMEXWZSYNSFSJZSDOQZSW UEYTYVMMLJNULVOCGXDYBSIIJOLJMIIEZXKGKGCK URRFMWBPXIASCWQETYCVGJHXIHBSHTEXQQMSYBVU CWXVUEUPHPRFSDPWALFFAFKELCXXNZLKHWHIYDZK AOZQMLRWOCNUPXQHSEFNFNCGWYVOOTHTNEDCLKXN ISDLEZTGAYMLFTDAAVJEUFGORGNKYEFGHZJXUBZK SWVDFFOVIKITOBCVQNMNRIMWLKHDJSIOEMMJWCNY BTIFIFYIRAEYWHADMENHZGDEZUNPQUQNBNBLGMMG SVMRPMKWITGKKSWLTHVBPORBHMYGWJNERYPYBZLX OIYVJAUROGKIKLNUEQLPQNPUVAKROOREOTUXTQZM MWHGPXFGUDNPFPMOXHHDMLAAPGJYEWWUHUKZQEJS ANSCPEIRBZUDWMLFCKOFHQEQFLCPIXRILPDFGUDX EECMKDBHEKKHXIXPVQLRHRLHAYTROCCNSUUIFKVY IIOLZXZUHKCCPFMMBGRIOOMMLOBMVRDLHMDZETCN NGKNGBUVZODCSEFGDGRCHUFUIMHAXVQMXMCILHMO CNYXGNVEYRGIEYSAMBXTSKEAWKMFUIQETINEWLDM ZSXFOQDMDHZBAGNPJGGNRSVZDUHCTQBRRMBOHBCR UCHXEZPIGTWFYHMGDXMK
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WGJQOEHRTURLZCWVDSOCKOHTOWLSJBGJKFEDKJBB BMJQUMUPRUTOUIUSAVRAMOERSJRXDDBQZPUGHOCZ KETUWRZHICVJWAGJKHUZAAHCNZUTUZOXULKCPDIF XODGGKGRNGYRXZYLFYRDOUDTGJEDNEBATLWBXVQF MCJACEPEJCAJOZGZEYSQFYBJQLNBPNJNZJNIIHHZ RIAYRHITYVPLLTVORMXFHPRVIKBBASEKQTQICXMU BBSYXUGASFYANFJHZRLBPHAWCQGLQEMZCUXYJDKW ASOWZUVWVAHUCSVCAZZJXMYHVZJXRODXZHGTVSGM JFQFKBAFFCJIAXDWFMCUWVIDUEWIVTCWICUXVUDA IYOOMDUXMILIKSKURHLPSBRKCJJTBSMAYMVSFCJR SLVIIURGTBZQSHLYQUKANTQVKOTQOCZTTBELRUMG BEYGOGIHRTVMKMQZCJKQBOPRKOEGYWERDLVARZYM QHOCMSAWSKJJFPTJCBOXNMLSKLILXXARLELMGQVS NLCRMTYOSOOWAEWOOEMFNOUIOSWMUSPPGAGGGNNW ZFKSDXSSHRPMGGMZSFDLHBJWLHDCLXLYUUTENYAN YQRXERQWABPWJDBNHRCJCOXNPSIGRJNKVRHLBUND UTLEKSEWWVTLQDVCGUOLGFTRIVIXAYFCIEVAFAJP WNBKMLQURBZVBUFSODIXOSBMXOOEDCRCYVQQMOWZ AYJVHBRCRWKDQVFKERFFEKMIPPAAMYUHNXZJQHQQ QRTOTYVXNEZFVPLGXIVKEICZJPLYGTAMOTCPSGSR QMVEUGLUIGAFLFCMVZCOKZMNIIFMJGLIGVMIUJZC WGJPXBMNKHQQLZILBCBZQMBYKYESQVQGEJMCJLBP PEYCLTQVVQPHKCAAYXEMADCNDRWZZGRPYDRGCZSE PHYOCVKFHYWQLQKUMBQBINOBIKXBCBTGDTLGZIVT GPVWXEBYKQGKSFZJVJBXFLIKTGYJFXGTRZGRJQTS FBVPCRUSDPUBLNFXOBHKMOTWMRKICJSBDLGBXCNH FKJOPHTXEULBIXAFSGTVUKUCWYGSLRUBZDRYZEUM PNSFHCVCRWLVLJJQZVKPABYWQHQSHBPDHIVTDVPD KNKJPEQGILSUVMKNHJBPPCDHOLDFYNAFJIZJBSRX PLEBRVEHRSCYPTXOBUMHWWWDDZYMZABLCEOWUAOA LNUNRXRNPJJMSJFWFOWGXABUUUSSLPJKTUCCAPTR YCNCBTKRNATDBRHTJZPLHGAEQOHEQDDXEFPEIQNO MFALHKOLABGYGKRVWSTUNMZPEGCYTVCSHDMBTDBH XQGKYLMNWFQXFOLTFRRZGVTMYTXCASLGXAVHBDOW TOVXFTQDGVVHNJKIDFUOISUIFMGRINRXPEEBZDOP PYYVUVHMCHCRLOXTMRKKARUXVABJUDIBTSTJKGJF OJJPRMHZZXLGWDHKKTFWPEAKKZVIHADHJRENBDMR AWMPEVFBCKCJDLFAOEWSRFZZFIXWABYRUZFWTWFV WPFGBOGDSPNJKHBBCTLHHKNAFQNQHPDANNBOCNYQ XEPZVMARHFXJKJNOYJQKJFQONAGTEJZSGHLQJMEK OLWORTWBNJCSTNYLIWOVTNRMTKCYDAXGVUAJNKTY NFCPDZJFNOKVGZYPXFAHZCRYGIGWZSNLSITVICDT ZLZYALWNYNSOMAMVYKQIZMEZRWTMRSEMWRZHDVOQ KXORRKXLMPKUMRPVTWGNFHJNBCXAJOLIEJHAHFHR ZQNZSIOJUSBGDSLAQSHZHFDJQYQHPIOQMMOUZSLD OJFHVOTFXCZWQKRONPBXRBJDSLWCUKJESSWXGIJY IEHUXGIYZVGOHJBNDIHUBEVTEIELXHBYPNJWFTUS MBPTHCVTOLYMRRWPDDJN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      VKWTJFYBJNLALSIVYDJXGSLKLWMRAOWQHNNUKPOL PBSWZMLAGDZEYSFFBKDIQPRZGBHOLTETZJMHXHRB LKMPFACGENJSGYFJCJBETRWAXJKALSMEUUKSQSQH WOUKHFZTIMFMQJLRLMSRQSDDXAQQWOAGVADFUQUU UJLDLJPTIKJDNWZQCPPWNSNBSJPSRKQKMYXAZZYC KABNWEENXUPASZNLJEWFDFRDHYBFBXZOCQMSLVXA AGPBPOEHJVIAAYCZASZPKBFJTCBTSPTPZTGPFPSB RCRVENVGBRTUASPBUDYKHENDUNQHSVCUDSDJMULG JZRCCZJKVSAPMAQRQPJEKBBFGDDBQIKOHBXUIZSM GVMAFEVOAQELVVAVZOFRGCFBQZXZJZACFPFEOEEM IDIGUTWKACOFFHJAKKMRLWPHGKWZNHJJZISLIUGL TUHSDRMNXFIRJZHLDXETPJUEFZKFNTKGGKNEXNMT PREREWDVYFXBRRTFRYWBMLQASIVBNESEHYFIPKDL NMHXNBYWNTNTYKDUENKIDUHWWBGZOTOKXJNDNJNN MTAACLTNYWGRROFQFLUIUSBUOMBSBKEHBHMGHMFB OWSDCQPZCLQEYJGTIRHLECMIOUKXNGQUVZBDUAUO HENJXARSJIZWTLCDURXUQSXKLUBIPHSJMLCXFAWB JEGBKTJDWLXPXAMPIZEPAMPMUVNGWBDHUKHABKYD WBKLRVUFMDHVUUULBGPIFCXZQDWDDIEMQVICWYNT JEMSPRSIUSSQYMBWDPAXKVIQGZGXJJWNPAFNCJNS WVUSWAKZOMFEZRVYRUGUNFDJVUBFLWWEYEVXPBVP OQNJMYNKPKOAOLAVXQDXUVVCMFHBWNSQNUJPEXJL TJOZGFXWQEDQKVUBBHUPGTHTQWLBGJVCTCNLVJZD GJNTXLNQGTCOEBCHOHZEOYAGRJZMJWQDPHJTSTIY CGUNENQMNYHIFTVPNJYENUOPPAWHFOFICBGLVZCK HGXAXPGLMDVGWKDKBTQLJAAMUKRDOEJNCVPGOXIL SJUGHJHBYIKHDVWSHIDBNFWKQMSHUTMTWMVWZFUT GOXXWOZGQFQJYZLRCDXVMYIQMPEMLCPCOFJITCJX MIFRRYMRRJLSKYLJKMRUQSRYTKXYNTLNYIGLGHMJ LISAEZUZYSTDKXBFAODLLXEIRFAFTXJMQSWDDQWP EXFKPMIGCPELODHIKEWZUIGZBVWECRGXPOKSFAQY NDTFKHPREFXCAKDLQXBAAVFUILRQNREINXKVQPIW CKWQEEDCWFJNSIJUAZMFBPQZFFQGKNREOEANBMSO JQFBFLVZIHCSKMWLOFTOFKTDSBOARIHCBWZFFSAU HPTCXRUQKYKAXTICVZGYBUTEELTLRDFFNUWBUTFN ICXTKUANODTTICDOWMSUKXKTDBLCRFSFLEDRHSFX UVHSIBTYSTXYRFAUITUWSYPBYTGNZGNROUZDNEDJ FVJXDBUOIFNJOXVERITYYUVAKCFLIULNZZKXLRPZ UTHKUITZDFFSHGEYRNBJVVTJLADZAZQBJBUVLUEU AEPSDOBPAVHKRWXHFMFDYUYXRVJITOLDOXTNZBQQ COOEGRCGNBVXXHDAKWZCHNHKYJRTSJADPLUYQSEL WHBORYUDHFSDUICJFOLJWKDQNTLLIDDLMHCUCAMZ HOZXHLZYQWTTEUCLKCTFTDAYVSGYMFMZSONTCBRJ RONZNNOHYIMPFWSFRZNMYMYPOGWXONXLJPMRLGWZ JJLMPVQFCLHQCSMSOZHRWCQMSUTTZPIEKCOUEWLG CADUHMFAIPCHXHHHCYZCBWWPPICHUFEQXVLHPMRZ IWOQVWOVDISXGOTZMDLLFKBIPSAKHDRCVOJEDSUA HFWBORHAOPXYQRHEOJTZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DUGKOWXADDSWYNKQKBSIUCXUMABJOPFBHNDFDUEC LTUYJZCGQRWDNUNEZOXQXBZQHLBZSPVVTCEZEVKD DEDRKKBWRKONAEEOBAXOQSNKMXEDWROHGCSBHCQY HJGGNPJBWNILCNBRLEVNVJMOHBKRYESIRUDWBKFM BQCAPIRQISLGEENQRNNALNPYKSWACYWSQWYAEWCO QKGFEKWBXFBEZFWHBGORWRGWLGDAAUTGAXPLXVAO TBJMJDXYRZQSNWHFLQBAONVAQALDWKJQBLHYCKBM OKBRJXSCSFDMGBBWIEXGEJBSJYTBOFITNTLLOUVK VZJNTJYXFVLKOQUVOVMPORJQXKRNNKYUDEPMSJFW UCPRSDNIZKDXDSVPPYZNJFDSPFIQUHKWLOAEGTDS KFWMBZWCCMAERSXMSWTKQRCNGKEAXTAQNJPKLUJS SSXJSTHPIOUJJAJUEBPVVPJLVNRWVHRARJIWVSWM CFODZVHDBUFEULCJESHHUTPXJAQRJUGOLSPUOUVP XGJGARYJQYNRIZYJZUHAUZVMQVXOZDFBTIDCDQDS SVMNSNTRNKDWEICGZFWZKTDBXITAHGLEQJZNTHUI QMSKVAWYYMDVXFOASJYMYRRKIIFNKXTZOJCZDFKJ CWPSFFFKSWYUOFKRTBCXCEKBGBBQECAVUCFSHWDG KJEHGMEHWLASLOQBAGBDUWVPAKSGVATQYSAZUNHW WHRNOIUCAUWOGFNUTENEQRUVNEJGUDTMUZENSZJN NQGQPUWZJRESRPWVCPZOWDIQNJDZPRNBAALOEDHG FBYFUDOAZBSZOEXVBAOUFIPHPPRVHATAUGOTRHUB RGHILTWOLMGEKFBWNUINZEBHFDBBDPAZUBNONGOY PLWOLMUJTCZYYVAOHYQPJUFIDPHHHFFKQWEFALNT ZLSSNQPTWJQJPNUENEJHMYOHYVPDJSJXTXHTKVSL HZHTFIGQINPQJTIZOIUHFPQKJJWKRUDBMGGDAGPE TMGCEUSWKTRHFLTAJCYLKHGBXTERCNBWKXOWKRKW WIULPRQESURJWKSXVJPUMEGLAHYTGTVXLJPGIRFW IHLGEQGMFTCBVEUZVOBONFWQSIRWVTCUFYRRHNFC JAUFNMEYCNAVIBDAUWKOAEGLOXQUSVDKFDDGWRDK CQFIHXYWZXESHLTPTSUOEWTROFPZEOPOTGYLNQOR UPABHFBVQNATTRKDSIZUTTZRJHTEDNKZRZXWTMSM FSZBDAIMUZWMQLHBDVDVXWXXVTIKCMQUULPECARR FPLDTYRKAEOXGXBQKWSOSMNQKTPBJIQDUSYIKVWW BVMNNVCYTGYVFGPRTGFTLWZJDGXJWMLIWJWLFNTG ESZMZQROYXLQYMWIIVCRLAMPFTQMDQIQFZLJYCGV UAITDXOWRAQPEABXJKNKLQGAMNQFTZRKDDMECOCI ZAOKLEUYXVOOJEQTXTWPXUBFHKEPVMRKRNNIMORG BUBCZCVGDWIDSXDUIFRTFUFZAHZCPKEIXUEHSUPU VOITKHITVSVJBBUILFABBNQSMIBFKEFIOZBWDDVC LHTMIOGAAUQYWDSLHVLFAHHFGYFNGUAZJXNDPWHO HHYJIPNRHIETXLATGRPZKSJLLKTKBHJQVDUSLPGW IBJERRMRLNVDOVMXMWCRBBZLPZJWYYWXWQUTRZWL ZRYPTZVBLNHDLGPLQXUJKVZYAOMRDGPQKBMHSWYE ZZOSFWIQTRDBWMAHBOTDORTUAUBVGYPDECXZBCPC QSEVLDBJFCNUMDFKLXHTTYZFVAYMMPLIDPXVCBMO BQEHAKOHJRVWLTGGQYEQYDODHDAOVUWOXTPSELIJ WKDLQEULHGIWGORZZZLSEDHPGNLCTALXUXOCATOX JBNYYBWPJSJQJJSKBNNJ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PTUTISXBTHVYNLFBAXNGRSNYPAUNQSQTQJXDCOUN JIJJZDOSUOAMOVUPTEMEUBCRQOCZFVJVTKYVHSCW ZDXYCLREYJTMQKMNIARBMFIDUSBDUYBKTOIKZPFC WDPCUVMIIUYCVYWYCSTZBCWZHLQSNZGFZRLCGDGD MFBJRVMTQLZUDSAVSYKWXQSSYQTAELFQUQAISTHS NRQRUHJAHHVXDNMOIHLMLKQEMPAWHJUIWJXYNTTT QMOFJZXGCCIJDDDDSJGMMJAOSHNZKZKXHHDDEYPY MLCVWHICWUGQWTPLDYWNQKMYJFWGLHNXJRNCEDRY WXJBDRLHQIABKCOOJQGQBEFXRPHKPBCLDXWWJUIZ NORTEFIGKIGWDMRAEQRXPZRLIMTALKFOSFSTRNRC OKLGCXCAPPRUIOBAZMIIJHFNSOFQKYARYPJSAKTI BHNLMHZKTKHIHSXOEHROVZEAMHOPEBURYDADSRFV OMARUBICPPOLZEIVMRXEIOHNWXKSOLWASZBOIXCE SZAUJWAYYJJDZUWZYWETGUQAFJJGYSQTNUVDMQBV TVSVBYEXAETAVTQKDEGFKAIXUJSKDJWDXHCBJUHT IRLBUGNRXKSRQUHAOHOEVKNQRUGWSVIVJYHPBZSM IXCWLWBAMIBDDAPLADLCBMOWKHOEXEKWTHMDWOMP RDOZOWLMZDYXISNAGALFABSPAQAXWBRHJOTGTZPX RHCTMHGECFWOIKHORFTBGICQFYFEVVVTUJPCIBOX JKVBLPJZRTSMPURAFRKXUCMMRHEKOBHQMHURDCAF YYTZXQWKJCYPCVLSSJHJMMPVGNGEPJEMSYCUBXUP VZIABTXKVARBWYKNDMGAPRODFBHLJYGHQHFCCIZP XUMYQRKIAXBDLEYNSULXKTJEFTXMIFXLBEHHCVPK UZKUTZSIYGYDFZICNCOVIXNENQFQDJYTTXKKAJFH LMPVBCUVNRYNOUROWKJAKHJBHKSPRZTZODKOSVNL WNPDOSMXJODXKNLKQMBWNVIEKPZHIIXXOBUIEFXJ XXUVRNLPJKLBWUZCIWXCVQZWSKKYSOJWHMKZVUYG EVMCLFNLKAELTVVRREPFXNOGANBWIGIHNLXKZJNT MZVNWPDZFRINCCKBKKRMAVHZJRWFJQVSEQSZLNBW QOVUJURDXGHVVQZQZYKAFLMFXYLCZCEQYIDOZHIP SGAFSPJXWLCVNQXPXQSBTWTQDCRNLYSVWKXXLFXX MRTLWGRQKFHBSTJPBCQUCDRTPGNNIZSVCKMVCGKB LSABHAQMCSFRTDOVYOCEDBULHLIWRWSCGRJVMXNA UOWQSJLFJUNQZWEDNKYCZHDUNKFHEBRPDTLMGGII HGSFRZCJUYXXKLPOSZOVIRWLZQLOMCGYAOJHUGZT CXOPAREZXTUZBKNTTVWMOGVVXUJYCDHIQYWNTTHV ZQWMSXJNEHUZRWLNZTDKCNBKFATHYCYOCZBTKNBC CDPMRUJHPGAIWCIOZXZEQZLOSFUOBYKDWSVCIBUB PNEBFOGWIDXQSUNNWVZPYMMULNSJINGIRBZKOKHH MPZCGNFPOVLUGQWSEMLDJPTRGGEYAKBLRFNGHZBO MDKAAEGSHHCZYMBBRDZMBSSSHOISCSNWLMMJZXYH DZEXSYBCCXFLYUUDICVZMLKIRXWRUDXTVRJNDFYY MEZEHLRRVTDFDAKLHGCQHROHQESWGTDRKKEZJIXG VGHIRHRCURQJOUMSANJSEYTHMKDNBHLJRACILVAZ QGCCTILLLMQKAJDRYLROJULECPBDMWYSEZPRIDSB IYUMONGCVRSNWCEMSQGHGWQGVECDIHFGNJWNORSW RDLXJTLFZCSFLWORXONURLSNZCXZUGGZBRAKJEWJ DBFIEUBLEFVPTVXABTWM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EJWXTAOUMKCTPMDNKBPIFYWWFNRVCGFKUEFWHXBK QEMUCJWNGKTEQUMCIEGRPMKOODXNBTVMIZJXZDZF XIXZFDUTAPCLMEJVQZCGQDIHBHSHZRVPJXMSILIK OHNKWWTIPWAJKWJYQNWJFPNZGDZALUXLIZNJROXE IPLQGZFUBENXHPNBPQJUHFLOXWGIMIBEKBSKZBTD ATXRERTSNTGQTYWQLBIXXPZSDDNXAMATOKJBNKGM RDXMULNDYMVCINKWMXKFRTWUZVBMIBPBRAXHQLEP WFLZGHDUDNDJUBGYZHFHKMWQTRJHYMRTFIKZFCUE TWZRQHBJLIDQVHTZIHSHJEHLRPNHIQVCCBDESFNQ XBYRWWUXBKEZSWMDNZTTJOSJEKMITFJYVVOJBQBL TPTKPHSUYZMMSMDZUWLLSEZKJNSXFSHSPYQQPHUD ISICZMFYJCROJFCPLTUJPYDSZLXIKKHALZFRLLJK FRTPUXVAPRMUYMHMNFJIHJBHDMJBOHCEYGJVKNVQ RFDIBRHKDRBPGLPCMZBDDBOSPZFBYWKNUIEBKHQL NXEVARPFVKXHSTDXKMESGQOWCYHKXCOHHVUDJMEX CAMREIKPBSTGQJVAPJLYKIZQDLAHIDNYDWTISBRL NSUOGRRCLYTGSSQOYUUTIBSFLAISYRINBLYHKWKZ YXWGIMKLBLIASPLCZJQUTASNUOSODKCWVGHIYCWF WTVEVSWVWWOHOWMATNZCJRYKHTRMCDGRPDFQUGZM FDBAGNOZJJABIVMOVJGZGOUMVJNCRIQGBIKXRKMG VRALNTRKMVIKJPLCPYAYHQZQJHKHHZQQGVKZYTDC CYHOMAKLVWGUJMWPSMCJLUKADCRMQLHBWYLNWPLY VKBVYWGYEQDJHHGAOGWDJVKFSCDFGJRSQEJFWNLM FREPPWTVVGZJDPEKUBUAOGWFAVDSWKHMYNSONJML UIDXEBOBJKKTOIPCSRZBSYYYPURLDDQPHEABVOSV RSKCQMCWITBZMFMJDKTDZVGYFQZGYWSBYHYOHWIQ IKKJOYRWEHMJTLAYDJCRJUJONYGWUXHMHSIKSVAG XTTLPTNUHXSJUCCKPLUMBEMELKEHUPQRXIKTLQDX VSZCEQAHFSKLNXVSLPHGHEDBYJHAZPROXYUBUMFB XJJCIVXXOFGXFAXXQSMNCFTJPEBNXYCJJNJFUVDU ZKLSUREVLVIZKNWEXYDDUZHOAKMVXEIYKYCQYGGL VADUUYHMDRJZZARBWBCYPDYKTFSBQBPEHEFTHSAB VGPPPOHWFJIDAGOCDLBGIDJFBNPYXHZXOAPTZSZP JAMKZUVMEXAWNURZCHIEKIRBUXKZOTTXHNZMNCUC IUHQAMJRWEXAZHOPTLGFSYWCPIUZEIHBEMGFVQQJ ZHIWCFLHXLOOMHGVPNOFCIBHEKFNGGRJMWKBLCSH JAOOMYVJYDFQGNNUPMNEKYEWGFAZKKXFKFDPGNQJ FYZEGSKCYOJKOSRTZOVKGISPSLMUDHIYGVZVIDVR CCGIIDZJTVFSKQKFTIGVCTGYRHEKEHOMLCMDCJPN WNXJCFIVPYMVPCAKQXKISLQNVLZZWHDCCUTURFKR OAXMRFTRDWOAIFCWAMMWBIUFYLCHLGLGDWOWCCGQ ASICVBEBNJUNGQZKRTQGTQULZPIKZIRVCQLMRLEK IHGRYRZYKDHXLSFJQNGBUXLSJEWFMPBIKGUHCJMA DCUQWMUDURDUBBGJUHVINAKQFPPUKJGLJWAYOFGH QKPFBLYPXTPXUVTBTEZKTMCNOPPGWOADUIMHREPF ZTNKYCULOMEOTGFCLMPLHVCMPPAIBZTBFEAZLZXZ RJKXYKWEEJRRNEYNXFYUXIXVEVAYRUZSFYLLIJLD NKNNCSTKMJDPLYLDZPVU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      UKZGXAQTWGUSZNSKFXHYOIJUIRMDDHVVWOXVAWZF BBVWKZVVKSOERRSGVURCVNCGWUWPFDHTQOXBDHWV EHXREJMYAOYZKMHSJQUJOMKMQJCVUOBSJDCNOAIO TSYLNOFYOAQAMDBMHWTMFOVQNKPJGEMUGKFTIFTC YIUJTUCHKYQYTQVLAGOPLCHHAJTFYOPVUUJVGYVK RNFBXUDCEUQFPALAJRFNWZNDBVBDOYAODBEMXSBQ QTXUNXROKQTRXOHGEIATLZXVXKIFLIVKXWZNQFOB ZPQPJKFVAGWNIGWNXCWMOSYCZQIAWSGEOZTBUAQZ CEAGUUSSSBFYDJOVEPGEGFAJFNVTVFFPMJRDJYRF GPPBCYDBUVFWUVMRRPSVVOCPEHAWSATEGIZBLUTU QEAAGTGKGBKRLGUAVHNQJAIPPJIMCGKNBUHCYXHU SKNNQTAZJSVBDVGHQWWOETIZVVUXDNURKWDTSKIA TXRQDOTDYDGCGFRRHMGNBSUSZWRGFZVOMVHLDQFR LJDBQJAPRFMADXJVENTYTKERWPBKPSJISVLBJLDA MBVRTJSAKZYHTEWGNKREMSBESYGOARDKLVNRHVVT KNRCNCHSJSKBOYIMUGVTRPKXNQUGHLZMRFNWJMOM TEQZRMAAAGXRGVUMCFSNCKCJXWOFGUZGYDLYYHYJ JKMCUNPDIULRBUSLGCWNZOJNYSDPGMINTQJTNMZX QAQNFIWURSNCHVQNQHNSPOVWYMYWSTYCTPJPKWEJ FUSOSVDLUFJQVTNEDNUPYFBSRFBBWJMBJDSRCWPU ELTDOBGGAPEKUJCUZKVJDDVGMZEJDTBIXCDFSEWT IJTSPTXTSVNSDXOEZVQGGFYCNHVHYMNMFMBVWBIR YYGCPNVBLDAEKHSKXLSIAZKLAMCMAEFLEPMXIMAP GAULADLXHHHQVGJJPUIVHTKGNQEQNYVGTXHBBWXI LKRDCUXMJWVMWACEZATAOEFAGXXMEIXLDJGEHGDE SJFDYOCOVSHEHVXSHMRMBUXFOTHLQBHODGDSAQJL NSQBVSRBJDFVXKTGTQTEOMDVNCKBVYILFYRRGAVK SJIVMXATJLCYFFUQJQIOCVLTSSOEKUEZBMPRLJSQ YWSVCMGXWAEJYKYQNZWWOSZQIVPHYGEYFNDMHYHM ULZLCLJOICTXUHFYSGRXKGIYKZNGJQTRSNIXDSCU IFQHUIQZBATLLQFIXMTCMZLKKQOBEVKEVPNQDKVD GAILHBJWJRHTXPHVISTQHBEEBYOINCOILXOCEVGB ANXQWMYOLFLQNSVLFJYRHGQPBIKDTBZMGUDFWQII PVPKQBFBWSVSBJKHRGBMIFOZWTXOXAXRDTENPIRG IZIMJCCXVNEIOVCMPRZGVMZAAPXWYBFQFPEJDLMG HHWVXKYBNDQLZXABCQRBOOPOIJOYVYILULZVELSZ YFPRLNPJNHRQWODONDVECBZPYCGSGRGLNFRRQSDV YZZCAWTMCVNSDNZPCALDSBVYWDKMSUXTSQNFZKQL KWDRHHIBVIGFHWQQWSYRIJYPOAAPOLIZASRKVRCH OTVGYDMZYIYJFTJBTYBRYWUFQFTILPNCZFPILAFM LMVSDTXBMTPDKSCPUIUKSSPQFMWWEBJCMOLCGMEQ APRULILIFOIUHLLFYKNWTGMZNTIQZHEEXGRYMRKO MWQFEDYLILMDPDMELPZAOQBYDBOYHBATEPMYMHYB UATCIKWVVDMBXTDXZGLNVZLMASJUIJHXMIAOKLMJ GKFOPGNORVUCRUUQZIUQZORTUECHEBABDUAXYRHW ACUOWGHRSKMNGCNKFNCDDLYPYZXGDXSNSSVMFDNX WWFMNHTZXNNBZXSUULCPHJLORVEZFDUOPHPOKQMR MLGPVXCEKUWIGJRXJINQ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FZHEEKVRKLKDDJVWDGYGMNPNRMVSTFXTZJZQWTPG AVPVHYGCKSHCGGTTDYDQHEOSEONMKFFIKPGXFTPB TSJDNQBAPJVENGCXAXRUBZYQOQJDKEBEREOAKMNR NLWNZGESGGOKRJULJKXIVDOUZVCCJOEKVOMFMVRU UPLKLZBQXUVSZRIMPUSOZSXZXWIVRJDZUCUICNCL JJMPPREEEHSQGCXZMBUELKAYDJKEZFNFDVLVEJVV MMHUATVHRJGXENXOQEJOXCVPEROLXIGQQZIERRRV YESBRJMBUXHQGDRGSASWEFSJOHVYSTUTIPWYFIAB ULKCGJMCKKAHLXCLIYOBZMDPSVHZYRGVZOPAMMVN CLRFEDPQAZYGXDTNFTJCMMSTZOZPAZCTHXARQGKJ ERQELBGACBLAQONIJQXVERBHVGERBEUKGHNOOVPA KIQOXEHNNHLIUJRMYXCHCDSKMJDUIESXFMLWVPVR YMKHLUWUQBMZARUOSJZISGEYSDTDWMOIEFMMFUKK UXOWECNCRIJDDPOPMVSLKXIWERAQNLNPLVNLRDCA QWLADUSOGEBKOOUHTWVLXNJRPTMOUUWGYTURJYED GJWDTDKUFJAROMNUCDASIADMSUFCKPPKQJCJEZGL CLTVYMPHCACQRQZTGQBVDIPSQNBNPPXIPIDBQKEU NXRBUKGQVEYTECEEHDKSDAUALZZNMFPEUNREWDLT QRFGLRJFZYCJLFPXJMWBTLNXQDFLXGMZAGUAZBVA IIJPIWVBGQOYNERJVUVXBLSOFXRTLBWKZBYLSFVM LXJCYRZIVLJORELOBHUCPJMCWJWWILWXBMMWUCQH LLRLCGZKLSPHZYFVKLVXGVRMMGFLRNKSCTETMRBY PJULQDTXBUKBUYUVCOSMRNLXMERBUFODEZOCUDVI NHYTADHCFMEFBIUQHATKZSETXIQOKGWNIKMZZCML AOMOXZARCRMOKNEKXPPYRONYPHLFYRSMQHOUIDWB HTDEZTEDHTLHPHZRFDEBUUWDNHDGWMMEQLVRKUCR OGFFGQWRKBZRFAXOAYOSDSTWIYAGEESEDIKJPEBR TOXNAEMTVYVRIAYFWCBWACBTJZDXUSMRJNTFVVAY HLQEDFTCGLOYTWFSLHNMLVYQCXHEZNGZRITDJHGB PKYNNPYDGVMBPYHZHAMSSTOOGROANSDVPYUZSDTV YCIRVJIQPWQSNSTSRUXZZXYRBJKICKOFBXZPXIEZ JUQPFKAHCUZSPFAASVIJEFFJIOLKDEXSDQFJLUIN YFJSRVUUEGGUESMHJQAXADMQIJQWDLXWUCWNDGKA WLLQDHSMRHULGFEXLMVDVJSLOIWJGMFSGAJOESXA NPWFQFMLIDCWVNXUKJFGNHXSHSRXUBQFYDNIGMFB KQPLTAOCBZPCMPLPKSCYWOGAMDWZWUVPZVVKEKIL NSHCKINRFJXLZXGQAGEMXDRLYSEAQDOOOACWRBTJ BOPUTVGUULRNLFUSDYVFYKADVJDPWMJGXGWAJEHF BADGKMVFZOMZMKQTDBCMIJVGYLIEJOVIDWNAIQDD VUWRQHWOBQAWJMAMYYNJZHGGLWKBLCHVKYJHLSFQ RFHYVSKEDOTSTIRXYOKHGEIIENBKGYESNWOZQHEF ZLVQOFPVGXMCDGRAZJGKKZKJYQTFBGWJNPXXSCMP DDJLCXECDUABUYUZWXVRAVSEVCSUWHRJEMCRSIMY FNOTGWRNXKRCDPUUFJVJEQHQCYUEICFLFPLHVCNV LHZFZLIDQBNFIDIUUPURPOJPRRLXVGYAPSSPCYFX PQUASSNUIKGDMVDAURZRPFFTPQGIFUUXKDJPQBSN IYLOSXWIQWUNWZMTLIQFLCYTPWHRUZTFYHQLAWQM NSDCAFKCNGGFEHIGUVRX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      AYQNPPHBSLTYAVZMFSKWNUCRINMVGYPGULGPHCSB HTOFSINFDTJRIAJPWEARVFPNBNHYSTEVFQCDYPRE GKDMZMNZAHVFIJPABMQQIGFKHZIBYGWROEPDWEFR ENNPFKKONCNBEKDKABXYCFPYYVYHBXRDCBZCWFVT RSWCUVYQQVIMHGSDMGXPQXMEWLKTWCUFVYRBDRLR WWWHSHDHCOURFOQMGBRRXWYZGMNPCRLIXMNTAMZR RZVUNVRGBQODOTCITBDHVLKIIBZJMFPEJCOQKLNZ JDTBTDQUYCJMMTSKOUUVLKAUNARQFJTOADLYSOSI NTUQBHGFYDSHQUFPPWGHDLTHXLNEUONYROWHMVBI XZROODIBPCOQQZANSVDIDJWLPTPLWHVLOJZQQUVL WDXJQZWBPNNAMECQIGSATXZNKBUVNDWHREPPVFGA BGPXANYOVOECMUHYDGCJHLKAQGVABRMPMNULSIRT DSOLSYUXTDLWXSBOCYSDTLMNKHTTSHNHSXRZXNTI ODHVFXXUEYNOZVTOHJNEBROBEPVOTXGSPBKQWJKT MEHGBBJWNOGAELMYQBJRWJYAGFXNSYXWILMUDJSY BRSMQEULAHCGCMKKSQLZSOKYYXEQGGGCSWCUOPLC YQHKOAIVKCNAULXZPPXXJMBLXYGBXTJGWFDQMZQC OCDAXDZDPKUUJEHGGNISDFQDLLKDMZLUODDMIIVQ UQCDIHGIQJAVIXHRIMUAYZKTBXOYBYVVLBEEKQHW QQGWLPVNSVWCVBWLDHKSTAIFIQUOUDXUOEIBGSCW XUVNALVHILBKEIGKJMDVHAFBBEAXDBAPRCCBAKQC LDLITYOEJNWQPDZFQKUKYMMCMLXOCGHNKECZCVUN IZFWPWGIJHFJIPLXHRSRSDWSYVPPHQJSWTHYBTWW ADTMNLOLJBWGZUTKGRMLDFXYFEFKDFBSZXUWYNJX JXWOCBRHUASWOVKYWLDHCANPODLHDHZQGHLFFVCC ITBQUSSIQKBBZOTVKFDMSOGONWKXUZIIRZXGLIZZ EBSDHESAKTYAOOFQZOMZXXHGVHANKULFKOZULTTP SGXOMQIULREKBGKLSFEQWPZMYEXQOJYKDVOFIGNC TXJXMKRNQCNQOPNXUMFTAWSHKQKVZITATCCYPBIP XJILAAJMPMQGEONZYULQMGDZNZKGUCYMVJEUYTTR HWBYRQMAVBDJCHMDXFJHRVXKZVSRXAMFFPXRBNDC WCKYFOFIRXWCFHERVOGWZLKDSYHUPYWMQQTFSGAG VUZPLBAKFIYMKDYKUJYHVFMGMEYEPOXHAWPXLYDH PKZYVXBUMEDZAKISUGEYPOHHCTDWPPMFWOXPPOUM BXPPEGOVEELHFYNFRGDJUISHNKTKVTBMZTQYXLQM FVWLBVKADKHJACWQGMMHQHOHQVOKYBNZIHVEXFWT XMXUBGEIQPZTJDQGZMHGIDROXNXOJFLIOKFCGLZF AUCSXTVZBUVERUHYVFTFPBCCGPXQEPTWDHEXADUW QKMOBOPYDCKUZZLTPVDLEBTMOKLKXJDQXYQAWIOA JWYDAKTQTHMDULUJJQCPHCQQYCRLTRHAHMQWQSWS KEWOOQFUKJIZWCTLCZUJDYRDDMBYQSLMBKSLKZBF UTCATKQUKNUFTARAZXGNEOKZAYURBQJSIFIHFCMG CQKPDEXZPFDNZTLARNLHJCMGKQGDEWQQKTWQBNEO NKPFQUPCQAGYKYCOGYRQRXQVAROSIRAYUEHVKHJC UZOVLNMEPVJEPTXXLSAQLUVCJFSLLJOGSORXVQIS POYHQGMIZJZRFYYUXUJNPXNYTRMDTNZWGPFWSWOR ALSFQPAECWUMDYJYWVWMOAMCLZAORHWXHRLJIRSC LITMMGCBCYCAFWRGAHJK
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GKXRZGIDBXMUKKVIWZZDQBTXRYIDZMEQFDJUIBGN LXOEYLSUPKCJEAZMAQMIYSVKZQGEXKMCCQVXRRYA RWOWXSZVALAZVYMYPLTUYUIHIJMELMJWQZMIWDYL ZCQEJNCRQVMGRNFINOWABDGNNSBIAXKZLAXPYMQJ SCZJXBKABPAUEBZRMPGYFOFGFJOCEHCMVIKACMYT RQCOSVMDEHBLFWJBHWPIFHTLUGWKWKBTUSVQZQGB BMECNURURYFURRWLMUOZIBBEWDNHVHTVRDHQSCBT EATPNZWOFWVPAIGYNPKJHAAKOMKKONZTSEGLOLLZ JMFOVAJBOQOBMFCGDVLSSGUCHVMXRPJUQITSMMSQ VEHHHHHTJMIKOGWHADGHBIDKLPFYPJVODVQKWUSP AXUCQXJUOTZNICEFGYGBOAXLQECFBOAZDEUXOXIL FAIXCJXEAXTGALOLEFIGCWYGTJBOCNMIWHHHTXFJ YXHQGWLMWOSKJLHEHOUBOWCDWWRICNWHAPIPTYJF RGEDYVSVCCOYZPIUIYZAPUPCNWFAOYDWZOGRSULH EMHAZKCNYNWKWOGSHRTMBQNRJCAMUVKXDNWYTRIB AVZWFPEGGWIPXRLXOTNPDHJGMLKNSXOSNQQEMKYN XCENDHOOOPPIGISCFDJHDLFEUPTHJGRPOBDHXLHN CKZGWQKGJFNEOWTFXOJWBAXLQFWWPSWESIDQQJVC HVBVUEQOHJGIASEEDGEAXIWRNMNQWYJLYBPXHNPJ CRALJXORIUWQTZLJNGDPSRMWLZMWZTBSNRIAWVPU VDEKLIHMJXAFSFMSMBKCVWQTKVAOWTPUAFWZGLGC KURAEFVDQTYUHKUDOWSYVIZORNJYYZHIEPOXHUBM GKQIYYSULSCFBQTLGGEIIDHRVZDFMXQBIPLVQCUO VIYFVXHDLYIZRXUWSWMJFDLAEQOVDCGOVEMMLSAT GYZTIPDOPDRKLMTAVJRFXPGCFKWPWZFBQVRDGEWN FLITAGLMYEJEMZCQRSTLTGWNTHZIOYXLWCNGCUHX NAABTNVZQIUYMJQMTAMJHCBLEFIJUKNZMZYJFTMQ UUNOFRHJFFCVMJAUCMSAXWPKSCGPBFHVZNYJZGQH RTAIYZFRMAWHSELBQVQCEQCCWNQORRGAGETVJLPB QFQIEFHQQWXVCZINDDUVJKTAEDPOSUCSCUAJGLZR EEGNTDFAZQYWGGJXLHOJNBQIOTLFAZZONHHOHEJH LTLCWIAKMQMGXJXQGBOHFMFNIMZABNPAWHVMGYSN SPOOZCGDIGODVVPQAOLHPQLUPRMYMVUJKKLHFEOQ NFEDYIQRWPSLCZTTWKSVMDVNPCIDAYGLFZMOQNWE AHKANICIYVOJVZFJBHHPUVCKUQRVZHVISDTINBQE WWPDMUTOQVQBAFHRRWPBSODFTOSCEQVCHMZBWJGK CNRGDIFEZHOZEZHFXGTVJAVGVKFWTRRHUBOIVDMW UJGLGKUENEJKDGQHRVYYPVXWFKATVGMFJUJGOFHE QNTECVDIBPAGNOVROGRRJYPZDONPZDIVIUXJHOJR ZCRWZQYRIPARUWFOYNMAQEANATLTXEYKUQLXVXXY MGYHZPHTEEAVSXKUTMNCTOIZLJYMIAIAEDSWPZOE VIDXTWUIGSSNHFXNTBSRKTKCNTPOBXBEJZASJWXS BJPEIMWBVRBKNMAUJFBWSZYMGEAVWLFQVQTTZQCC XSESFPKHLTHKKDSXROXBVKNCUJVILDETTCDUAQLN VWWJIJBAOTXMSDQLUFLVYUZXJGHLNFQOQAOHNGYR IKFWFISXOWFYXWSNFRRISFIBBBDNUEWIWXNPGTHG YKKBBDAJWGFSDUPSHGNBTOYECIXCIPHFIMBFTVAN LTQJLADUZRBPIAKGJTSO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HAMHGLRNNCELMTSQURXYWPDTCFQBIMNFGHDIJHNA WHDOQWZZDMYWRZPZQNQGUCPUVTYKEJESCBKGUZRM NMXSMTDCEZNJCMUJPYMQBEBWSQBYQMZLJSCSJTBN PSMGEYBPLIDMAUBVCBWCSPZLUNCNZBOTNESRSWPE QDBPUYKJHLEJLJSLHWPPPPDNTFTHGDXRFVCUINNE RUCAGEUZGKXHJZUVGGQEZSOHUQNWCXQUNHUBSBQA MJVGHOTKXEHUXEOUZIMGVVRMCTASZTRWSVKGSVXV YHCALLIHDDIUOKDXOMEMUHXEEXFQWDGPOBOJVVIG WRIBDJTNOEUVONVYLCOUNLDWQPIFLJRFSLWEVEZO GAMMUEPAMFYZFRYTNFMMEPLPJHPWAZHTGPONASJD WCOXZMWACFWMOKZLMVIOAMRUMRGPRPIAPUVGFCFL VYQSAESCIOKWTAYNRKCPLPWVTMZICLQCYVGMILJG JUJIZHFJRELTDHLFVHGJHJLBJSOKZUHWTZUOAABG JLZFUORYPJSLWURQLLZUEFMOIBSACZLLIDFJCGFJ QGEWOOVMSGYCPNVOHMQQPWLHGVPDIXBBBRHIOKTD DUJCXREBPNCHIQLZGDZYAGSSROVTTBQVISDMBFVU ITXAUWOYNHULEMUFZEWAZRZUXSXGBAPHJLBJGYSO NWSNCBLXJONOOVKIGYSDPPJBUHOGBGWKVHBVDMQT FYXOZHWXCCOYAIRPMTZBUKFXEAMUKBLSPWGUVWLZ YSDVXYFVKGORGVFEOXERZHVAXNESSUIHZXURQMVW NEIAAMHFRRCJEQYPVCHKXOOJYCDUWEKHOCYIVEYX URYHTZSDLHSGNSKZXFWYKFAKAEEYSPXOUVBIWYTY RAWUFWXHDQMAVMKJDCVQEMLIWMWSIBZGGZTNUNKK LNKPDWKCHIXDJZQWIBNDWGTGPQDTPEUNKNVVWDVU RSFVNKQEFVIGHVZQDXFJLVKYVHMAFABCNOCVYDJV AGEUILKUUKWRNYRMANNAOWNSNGYVVZDTGYTHXUNJ BJPSENNLTMYOXBPIPMCGEBUQBNJVBRPQKRNMNWUT AJKCIYNJWSNTULBSELHEZHNQRSQUHFDGAGGWRNCM CLETAPASKAWLFLNHWAEECRKDYYRKXJNDSFKPLOFB PKNUXXSUYGKPPIZBHECTGHJVGLLAGMQMCANSGZQJ VNTTMATHKWKITHUBBLHXZTPSCWQQGLSPWUCYNZUF IPOMODAQMDFMJZMZNYVTQIYGSEOCXZZCXUVSSLIB BXPFJPBKGKKPVGQIPEIBOKAJEGCYVGUVAQYDYBWU MUXGQZISLNPCMMNJMRJLGJNCHXBGERZRHHJSZWHT GJJJVKFQPVQFICKFNZWVBGAXUBRLHJTIMRZPZJTN UMMJYWYXARDOAXAHGTISHUVVWAEEVFHVIJEBOTLR IYKLPAJOVTXHLMCUZCAAHXITKNOXPMQZYYNMWTKK HZPKZVBULJTUEOPGLVVCONQIAFDMXQFCLYHACQAO SLYSCXIYZMAFFAYHFVCUOWDQRYZZXKLCPVQGNSQP UNZLWPEDIQLFPKMZGDCDJKELYGFHCAFBPFZAHDWF LNKOZDZSXFYPZXSMXIBKCLEYLRSJIVDAWBOSROEN XDRBSEDPGKRUZIXXXBASBYNYUQMDESFXZWPTRUFI HSAEZYACZONMGJSSAWBPIQSGWSQJAYDNQMHYCQIP VWLGUBHQHLHZPRYPCUFPJZRQTAKAFLLWSHEPRFCX OSRQXIKNSONEYICCVJFTIFYDFAEQONXDUTVPQDKU KMFEPAYQHMDMNSSQVFKAAUIPDVMQTEXISXJQTNOF NBITNRXMABDVXDZKSXPTYRDHORGFWKGLRWRBIXWG HGGBZQIWIOZMARBTPRUF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      IXARKSRKRMDMDNITTKZINMVEVLMLONPMBQBITLVM NIHVXYOSXUEIIFQBGSZYYRZLRDYWKHKAMHXBMHNM WWDCVRVMTGGCXHNQRKPUMAQBOFUMMEBMELWXOZRV RKWDHJBESVNMRBZCZQVWLUFXUNLHHLIXDEXPIZPP VIFCYRHNDKKQBJVYIYTSMSVNKCLRABWGVZBVZCXS DYBXZDDWFYTUGQLWVOIHEOQXAJEFSBXKWGUGSOGA UDWYDFMKIEVPHFDHAOJMEBXIRMETNGFOLSJOYANS WBQIPXWQTXYGGEVBYOZSCKJNDACCVTMXYNVYXXQE KRDXFBESHGIDVVYOZXGEKUQBXWIGFOYTOVQLKMQG WYQALSIWQCJYYNAHQYOJOAVITDLIRSCGMOUCPAMI OLYXDFTMMLVCJQWQSWYPBUREYRQFRCLZMEJXHDMG YQSANHBHFRDEWKZEVTQKSFVZYVFEQUWZWFPWPWGF SBQSHUVEBQMGHPPZVKKIBJLENMDKHNXXPDQZXUQX UYNXITCVQUWVJIQZUPIXBVBACNWGYQIRDMOCXMEX QDJFOKKTLVKELTQTKPODMKZTDLUUPJKIEBKJUHZL VNUWQAFPZXDDUEBRHYPWALANKGDLJZGQUHCZMKVH DQFOMWEECTHLLTSTONMBLWRJTTITNAGRFKCJIMSK PHDXRQZFUWMSAXLZEEFDLDGGZQZBGBYBPEOGXMER IJXBLGLMTZHNPWUGNRIDKGPNDZQYBYCELPZSNUFM VFLAVNZOHXQLIVDKOFZWSCCAMNACEHQONZUJACGR BKKVRPRLKKEZLAZAMAXYNCMWUCTLYLERBNSSXGYY GOHAQUASZBJWWIQUSYKMTPIJAVTEHFGKOXYVNZVI JBSUGPUSPXEWFGWZOHZBYRJMLIESOSSDKUARSGFD ZWCWAQKKUGGWBUAIKRWVFDIWBGYLAKJLVXMGYEEY YHPXTXVBLWEDUKJLWLEBYNDIEPLXDPLUZERWLWGA OTSVWVQSLWPNAQVPGWDJZBNFWRTUOJGSWKDOLQRV TRWRLCXTJMGYDIDNLHHGIEHFZHVOCXMMGWMCDLRC AUJLGGAKJDUNMVDMJFKQGWJWMMRWBHPDRMEDRZXQ SFYTZYXTJKKNUTOFRJKZEQAJLKRAEIFJMRBVZWFR PMFOTSELFASCYKGCPVLDCVNROSKSQQBZNGRYAPAA ZMHDNIHZOFEYOIGBFWCNSNSKYFMRBZMGSXFSBFFV LRMSMFUGZQJEUYZIFPFZJJVKSTCBJIZLTFCRNBSP GJZGVTIHDDLEECDROANTEVJHJGMSQZRLBCRIUQDB IHTCXGQDIYTAKOJZBGENFPEQXMFXQZSBRMIKKCVZ RJPXFPIBBMEDCUGCIHROIMBDECXKZHPFMWKAJKAC MCYIEJYVWVCWXLSBDJOYADBZJZOHHRMMEKKTQQJN MDUULTRYTNZTSKNMSWGGYKFKPCMSPUFXCIVVFFXG EXUXSYRHSQBENPSOORXSSGBFQMNKGHNIZMSPGMTF VIUIWZWATMKNDJSCOQCDANDRQKLFOZHFKGRLJRLX MECIHGOOROBJKULRZGOAFEKZIKBHTXECCJKXPIYQ OBUMCHSVTKSNGSCTZWDIBBBJQSXHOTWBOEPUSDCQ HYRECXUFSNRIZHLHGBIIRNJQHJWGSZWAKHAXRSNW AQIZAROWYUXPCFONGWIQJRBDMLFUAIJKWEQQDJUE KYIGPXLWMUZNHQLOHYBMQZLGEQSHZJRNCSQTSGKI TXUBNSHFFIFFGYERYGPLCAMBICIVBXZRZJLRUGSX DBFCMMJTKLHCMUIZLCPANQXCGNPYZIJOMSRLRFQH CZADWOIZIZTTKEIZJZOLKRFGVDCONMBQTWXIEWDW WBNKFQKFOYEMWAKYPNHL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HGUDLPJUINWSHQLBEUVHYAIHPFFTPDTHIFCXBBMK PLMUVBQXXCNUNJOPDQLSBRPEJFLZXKXQEATDXTZJ IHMMEGFAURBGCFWBCZFZPDSUQZQULUTZXQKZFBSF IOUGUASOIGGUJBTFOFRVQDERQCTVVETNESKITAQU NWTPNMWYGEJAYRNZFTKAGPGKOPDRMBKRNUHTQDAK RDMFKTPWFMIMTTPOMQLTKZGNEWZBTGXVJEZGQKLO NVENHVYETGGIXOVDIYIQGICSCCMJRNIZOGLMHDGR VVGFFYNAQPYUUPPBKUJZOEMIJGNCJBNCOKWBSIEA KQSGWYHIIXUSOKNLXVVRWHXXUYBZWCBPJBFKSMHP NWIWBFAMGTAPBDOPLCJTYISTGUCVDPSASMFGDNMB MVVKUAEXMLVBUSMWZNEICRGRSSFJTQRIMHGHGMGN FAMZZLTARRBOFAAUDTPVTNTBWJXTOQKRHHXJBYFS WWHAULACABLHVKOVBYIAEDHIWRVCDYPDNQOCYGQL ZVAPRNBZYQAKUQVZBSGKYWXHOFKYVMDYCBYBKKBR SFSCQDDOHEQTQSMCMFEYNSJACQHDUTGKOHNIDTZA TWXQQCMWMGSEXHZCFIXEGSJKKNEAEDKVWMCJEIQJ OOSHTVJVHMTZRAWMYTOWRWIIRGQIUUBDBEHOBTMM HSLIXHXRLQRSKDLDTJGOYEERFOPPHFJQASWAIWJX UXRSDQXPVRWETHOGQHENMZLFAKLKWXNPIVNPTVHT MNUVOQSZZGJHRUKOJOZKTKFCXSNDSZGTLIAGXNWY DLUACIHTDYXDRHVYSHZDYFDGCQTCLAGRVKQFGXHN DTXZLYNZCYRJQDUUYYGDJQJBPLLSFTHDVAXCAGMB GCGZJVXLSWRQWHXKVWRWGXXIZUQONVPZQSBDTJXN YMHLQUYOYOMEHXRPROAVLVASVOLJYHXRGMAWUPGI NNLDEHNYWGZKSHTGMPGBWRQFLUCICGIXXWXIHFFH MQENZNMEURYCDBHIWNMOKHNRFXHMOZJCWRACJPBG SJQXMNDCFVFJRHXVSSMDTITHHHTXQVSCVHYDFXZE IZXTKZUHJZNQHOISGKBDEFEDQAYEFBCBIGBVXOJG ENUTHDVNOHAVKABJRYRWONIVSXORDBLERVWVXULK POIYDJJAPFAOOSDIFDMBJKNXFSKYQKTRWROZCIMY FJHKUBQKPATYSPLOBMGXOPBNHMMYDDQADIJSPWNA LTCZUSOXZQWKOEZYDNKNAKKGJGMNFWNWKMHVMFGG WOKOSYZYNEBPGBGUXEUBPYQJSNWKSWRZKQQSQFDH TOQWLXVVXGHIVKFKSUHMEKPQLPLJHSHVXKRPNMPP NMDTNHBXPAAWWLRNWNVRNNFSGNYUDORMKJLBBAOI KQZQWODDFRBQWEHAVYQRIOINLCBVXLJETCAGINWX NAPXSTVAUVTNKPJTWONIVPNJMGNYNZTICWTTVZZB WWNDFEWTDWPLWAURLTAKDCSGTHAJVKWLVUJSIJAE MYGREGESFPFTCXDHFKUCMUCZEHINQXYWSBZJWXHQ YCWLERSLXIOEQCZSOABWLHRWRWVVORTYQPXOKLOB SOLZHBQBKFPEZGJOSBHYMTZGQDBOWYOBZUHVGIPL OUWQJKGUEJYFNBPPUGHGBUDIZKUZRBOTWOUAWXDZ WEIQDJELXNJFCCXJDLMXLXWYFCGVUOHFBNEYWVZU WHASGYRCGVULIMPVWHEXKSNPNYJGGHPPMQMAZJOE CPLLPBLELOXXSWSMWCOIKTUAWNCKXEKCXJJSOWKO AKHDQSGLJBHCWANFGQFDEQBFXVHHCCDRKSNYHCOM CDOXOMQGSNKOXZSICNXFXFVFXRAMVLWPCLRAYKBF YIBNCJUUMDMCUPOIPQME
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GBWZTLVDWNMLFLCVPVHIRHTMGYSDECPDUGRQYLRC HIDHGNLCPLOHHZNJSMPGODXAIBBESODBESSGSVEK BROSACCPFTWFWKUFXZOZWOABGCOWVJYITFUIVSYF RZLGIEEXTEYCKNIKNMPPFJDMKHLRGNZDCOOLNYWV BPNIDUQHQGDVUNHSFIVTBRPCPYHCSZYWTXPCRUXT CMOJVXREAAJZVAEMQKCZCUAOAGWGVWGJGJPMYQYQ EZRBVDSVEYGEXKTRGJQPHZJBMZSYPWKKLSGSUXPR ZADUYTEIBRSYIHWHMZNGSOFVLXQUTFYDOOYWSYYR FHGWQWQGPCZRSJCWRRMUWUUMHEXQJVYUULLGLDZX DBUHSIXPORGQUSGELAHEGQPOOLKYDIHHXHLYKKZW OHGESPAFBXICSTSVVVGSPJASFVKQVPLWJFKESLLV OPKCHTYOJORJALHZPSUDRSGLCSDEGOQAPRVVQAIG GPDDPCYBYFLDLIHTEFETJOPUBMKLHHEZANLEMQXJ ACEVIMDKPJUXHNEINAOGOZRXHKKYYPEYYOPCMLCL QZBCFTTZHTEWTHSDFYFYIIKMIUQKJCUWSBVEBKBZ LMOCKIALOEMKQDEFXFBXVKJGBYEFUJJAVTRFOSBS BLFGGLXVZMIHVICJHPVCWHKDEUTZNVEMQSJEQDWY AEQOFAOGKKRBAQYCEUQEMOQTRGDNVOGULZKTPEJR NBZEYKTXYZOWVBPMHQSIJXFBHDROBATCWOBHSSFA BOYCGPZWOGENNONLNODKPFTITTPYEGUFFALPBZKM CEWBHYDDMTGWJJAJVBRYZUETWZEYBDMYPPUXBLGH DQUINGYVNZOALAOCZYYKBZUTZWVVPHBDLFVDOTYJ YWWYJQQNLJWVJIKCNBQZDJCCZAWVQITIPKMCGKJS AMOTWTIRVKAKRPBWKDBJMEPPCQHRDHLGAVDANMTI QLPFTASJXFPIILUURJXFCWCDPGRHPHKMLTEXBBAC FYTVXUYJMZKBFLBFVTOUQNAUTNRAKWWSBJMNQUNX UDBALYYEGLBFZCJKEQKSAWMOUINLYHLPRQZAFOMZ GCTWSUKTKWURBAYKDSHYKTRIXUMCBBTUOJILCVOQ BZCMWRUSSVLTOKYFVDMCBWAITZVUTFFFGEYWMNGQ QVUAJYDQATDIAFDERDFUBISBTIQYLIAAKEVSPYQU DUUYYYONVZXYHLRNSCBEOLALWSAZBPLNMXZFSSUH FYXBTALBYYXEOFUUWSZZHDKYYACWRZOPQPSALXDP GWYIMSGCIJTYJJVPYRSYDNUDNRMFVBDEFRCREIOJ OITASOWYJJANGKRDUNNEIXMONAMKKURHNBRRVUOP YUKOKGKCOTEUZQOSEXVDYTHDGDTVFZSXNZXTROJE AGLFHKLLXMYNCEFVBSTJYXLHHKDVSOXNLNXIJBEX SQMOAJYWPOOCAZSWDZVEVYBJSDLJNNOJTGTEFACH MSGEYETDTLOLTPGPASEGOCEHXTFQLQCCMJOWDVSW DBFTOXUJREJGSOBFDQPAINBPVCLWEWWBQXFXNNWB OYYLQSETKXPRRTXRSYQCIXAPNJAISNEZDDGRJYLH NDKYRAGVMMIENDBSENJZLNUKVIKDLASNZGGTJZIO RLDNJHGSWREJZCUTXQLXWCFFEVKVLVTWDGHCGTCJ IYCTYFLGBFRKVHCRBHSTZNABRWIREJSEMTUKJDZY JVSEPBQXPEIQZLOQWPNCFIXLZHOKGAUILVPVYETC JONZXMWARILZPMZFYTDIZGMBHJPWUUQZSHGLTTED GQPIEFBJADHBQZBEVRBNKTXWPCHVDTZTGBUPOAZM SPBNFBENBKXRXGZHJNLKJDSGMRZYRBMOKTBDGBBC XUYCMSVMFKHDTDMTIKBF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ZWGYLIKRJQPEGLKDQPZSPAULYKWYNWIMTWKXKTNY TZIJGTWUTUTZOASLUXSNKOHKFXEYFLBXCPSGZWQK HAFWGNLFDTKSFSZMCHYVXBHGKMCKZVETWBUDMBWX MCWJAQZQNTKMWJPEIMEMDUJLELUJOFCKRRBQGYCY HWHVYHALYJFIOBRVAMBCVDVDGUYKFDAUGCSNJUYB PRWNHJDRRJXIVSSMHXXBONPZRZRRLQBSZUTWNLEJ WVFTRVDDLILOIURGQETNOJQSJEUGISGCOTXJLKTJ YBMPNFEGEQXSIBVBLCJAYAUUHRAJLQVDBIXOVJWK DLUOGSKXXEOLNBAEUZQJXBOHVOMLFSYYDYWHPPWA WHMHZACCTZCBLKKFZIPSZQHYWDGPQJGEKAWPIZRL PYKIQJBWFHUWMOCMNZOXKSNGQKNDONXMLXILJZNQ FOAJKBQIUZFPHHEKQWTNWERHKPTYBCMIENQCEUTI CBOIPVJNPPPCEORFDPSPCPWFXDKQWLBQLBZMGSJF MUSZUVSUSVFFHDOSOHXOHZLPSHZJWVUOBBAOOCDN TUOCZVABQNQJYDKQBAKYVMIZGSBRVPMBDYSXLOLW KCWRTEHBIOBCZDASHDPBLZWODBLBPOMDBACCIOZQ QOKVODJEZXRKSWYFRFNTNQIAUPZAKQWPEBUVCIJG SQQOWZZKZKEYKDEHLSEBSRNHEZDOWUPTNYKDVLED QMIOKOTYNUKYVZITMUMJAPTSRIYVTUZTELUGVRNU HHZEBSJCFNXDLVRTWVUVHLHRGLSWZXVKEYDOVLMX CLMRUVGOEBGCTORKSMRUTJMFYGXUVEZORCHAFRBT DJZLEQCXWJDFDZPOGBEHDLTRUXVIQUBKSFZQISDO BTSYOLCLCNWNYPBYRUILVUFQNQZBWVTWXPQTVWZG MTVXRURCKNDPLPEHPGDIPQZGZJFQZMNWHCNVYZFC VCWXUFKAVWGAMMDEVAEOSJUQTKMZCJLHQAVIBBNO YWZDFJITXHIFDXZXUXKVXCHTINGZDICCPVTJZCCO GGBZOFTNBHLAHCELDLNLTUHZVMQAHQSBRMRFLFHP UYYPLJVRDBDIMKAYIVXFEQNHSAVGNQMXFKFMLINK ESCEJTYCXYDUBUCQLCWHQQCYUEZYDKAGNJAVUTGY XCBKJRCCVLUYOPWVWANTKONRISPGLFLWYVELCUAW IWGJDVTIYKBMRFANCVVCCMJQRPUSRJVVBLOUYNTK PTHKEPMBHMHOHGRJNVIOUHFFZYDQIDDTCWDFKUMA XNTBUFJLFJCRAFVSWRRGOJNNPCPAOVRKGGILCECG OEPLUTMZTGQPHECJQCTYCAEKDAFBPGTHBYBZRBMG XLCTQUGRYHZRGSGAGZQIEVYTXGGUOSMUFCZJCXHL AGABXBUXMRFTJWICXOWVFBVGQVUJWCAUPRNIELLF CJSTXAAVBFDQGZZMKXSTYPUVMQSMYAQWHAFMQJQP CBCHYLVVNWTVHTUKDQAQHOYFZDIVNJNRHELDFMTQ AAUEIAVFKAJGGCRQLDFPIXAXUWMCPDLJJSAYPHZP EWHYSUYSEDHKSZWHNVSSHOMDNOUGUSIAWSNLERWH FHTOPSXDYUUPMIWJAPBHHBPNMTMRTNELSVOECTCU ZRPCCQWRLJESZBCCCLAPEHFOGUMHDLCPUXSIZWZI MNGQCEUGKIHPHQGLAPMJLVDZATJDNMRYKOKMIJWZ WLZZUQEAMJXVGHMYYUCASYBUVITEHFKYHDWCGSPA ASMWSXGUBHPJEBOFJLYMMGZVDIUOKYGIWFJYKUZK YHDXFLBJRZKWHMCRTDKZHFEGXBJEZSVHVTGYTMWX GWTKOYOCLAEBQDPMOMZGQDKMBPZAHLAOMQYTHWLK KNRGZXHVFYZBIKSHXJAD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      UJLGASNZSCYDMTKKYGJSVNZXIROHGVLDXDIDIWCX CAUMFUQDNTQDRTHUUJLRGXGFSHOKWOPOVUAHXIVB LFSWGWQPJWHWZHSLHCCQIXQFTQNYWLVBBMPJJCZO IYGWQHFCYHOZMATLBLJLJIZJYYTCODNFRDGQGUUO NLJSQUHAJYDXESQSHXJOMNUUEUFHRNQNDUHXSVNK TSKGYPTQZWUKJJQZAVKVXYXGRQLVBSAFGIDYRFLF ISYHNERQMIFZFLDGUMMCXTNTSDUCQFPKWJPCLVQE TSUPJYCBSJULRAGTGZHSRYEJCDNBKUDJADRNMGXQ HWJZGXQXSRSEAOYKPZQPMABBNCLJMDDCGXPFUHTY HRPPULXJZSHQVDCZUQVGKGJQJRKHJRSAGVSGLBMY PPRADREJODZXXBDIRAEXPKZNFHDTJAHVMUTGFBJM IIAAZGIMTFJHLNFOTVQXCFGPFBNOUNSVZZGUYYJP COTFRHVSBARLMOBQJSZSHWPDDEUEVFNPFBIVGKEV BALUHEFPOLFJBHQEMHRSTDKXAIRYKTEHQSVIGVUR XRIQVCZUZTIUCRQQSHMEINYDQKAAUZPQTLSIQZJG YUAXWZNEWJTPVJOQQDHSWRSYZWPXHZYKYXFCZKEC RVIKVFHPJUISZSSDLQUGMDXVOYDTSUGVFAVFPAVD UBVXXFJZRWYNHHIGCBCYFOTFDWIBGVCQOQAILUHH SSBSDJORSPARRNKTKQUDVPTRQGCAGTLKQEROLKMD HAZMRLHHWLKJPSOBNJDFQEIAKJVDKVMSIAYLRSVK QJNAACDQNRGSHIBQGXLNMVPIMNJXSEKXJPCRADJE FVCHMZGSWBAZUFSYHPIWPAXALLGHAFYOZTAPMXMN UHWRRTHSTSOYOUIOAOIFLKNHBXAZKVKCMWCBUCNS LRNYTHIWGOVYTZQRWWMJPIKFELEMLTEKIUTFNFPN IYJJZEFJNCXYCOIKZGLYCXTHMMZJMWBHTMDZHUDP CWDCUSJOSJWFFRRHKLSTTUHSNQLPHBMMLWVHUXMR IKUMQPVULGEVHRKJUVDRDWSOKPGGCZABBUDJPZRR TEDNVHFSKCPDCOEISUFYGXAMFTQVIBRMOUJVNRCR KZDWMULJXYTQJUFRPDNWUPXIRBUNOKBUABOPBVWO RMNPYHJTIXARVHLDIWSSGRNOVPRPUFSMMGNHDZLJ DYNTXXLSFTFEQQHAHEZROYYCDPPODSIOCJPXUEFS CNJRNHYLAXOWDQGMIHTMWDHHTEMBIMJQJMQLIJHY AFFFDKXMFHYTYNUKNAVBEEZFKSHELLEFQAKIJNEH TUHQLLRWRKLHYYZFVNFPEMJZDGKPCDROSKUSDHOU OPALDIDOANCQHUZCPGACPMHFELQTYCICBPQLWGIE IPGJQVWFQPQBXBYXEWHDPKOUPUTLHVWHPDIPLKTZ QTRWMCXVVAYRLOAHTHXJYZJRODGXTXQHMOLTDGJZ QINTYROCJHINOASWARPEBADSWKIXRFZSTWUOCZYU GADGZNVBLLECQSBFGXFYBEBBWKABQDNCAZJKNHCF THPJXILKSBQBHNGKLSHCRDUQRYPFSFFDZVHBLNKD TESENCUBWQMMOWNPQJHKFZNBOTHUGSRUQNFKNHXW PLDVIYPAUWGCEOSQIQECGVFSEKHHYLCAFQMMJCUN DCLLTQBKNCOBGRICEABHPXOQZRBRGVCCSMIQFCAT QLQGLEZXIBBICYPSPPBPAMKPAGWKHWPBMHZUAZIZ BIUIMTUHFZDAFLTVPZTLRXKKGWKVIMAJJJMULRXF OARNEURRORUEKXKLQXKIWTCNKXTKLLNTKHRJLWGE LDGRKTJTEVLKZTZAXARBWNZQZVANNDQWYXGDPILH ZMIXJVEYBHTDJTHIKJTG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      CGRRIYEVIFZPMAMTQIVJHKMCZDASHDCBCNXGJGDP UCNCTAXHBTDRCDCHCIOKXSYGHCGXRSRACZXGQPIP POUAANBSAGFSDRNURGKIDBGTZATHEQJFGOBDHADJ XCBXHPFMJNIBGKPVJBYFKMRDXSNRWQEEKIIJTZFX VBXZHXOYJXSGGRQFTXXRARHOIXQJIKNADMXUVPXF APGUDYIBRLZTWPWZMYCOWSXKOLSIWHSTONCJQZDT OWXGYJUSNDOHQRLVMCGOQTQMENHRVRXVQIMVMOFC RPKZGQOJPKVNNWSWTSQYITFNZEYCXNWTERUWDUUC HPGKHTFKDOCLASXVYICNPCWYECANXALDZWDQIVPQ XVPBVVOYBQJEVODJKLEAQEMRMBWOSIIKYPIXTBXJ OCLDVRZQJYYLGAIOHBDIUWHLWUOSJAAOHPQHMTYX TGPCBPDJSYQSRKLUIHTXNKSZNDXPBFMLCSHQFFOF NBHRVLFNGVVYNNTTQHVBYEZTFMFDUALTKJXOULJT AYWNIYNEHHSKHVADZSJQIWKKEXBMAMVRUWSJYKKA QBVCEKTZPQVJAUFLLDSRROGPJFUKLJSXZYXBZROG EILCEJSGAWPSOOJIKYAGYGPROEEFKXLTRHCHJYOR WYOJNDVCSETUUTNYUSGHNOSCJNNXNTEGEBSVCBZD QFAGNDFIXGEADRXZYSTJGISOSSJHGXEQKYBHGUOK TZZXGBHIRKXHIHLBRTDKWJTBZBVAPSRBYWEDKAMG JUUFPONCINGAGFVAXYZXEWHOPRSTVKCDTBHLFDYO MELZPDBDYJCHRLWEJYUNIVUGKOEDCPNYPMYVTDZT HEWBKHZBFHLNRTGYLREMBJUEVIBUNZBNRSAFMLHE GQMBAOOGJZDKFCTJBJWKBWUUNVWQMLUMKJKUROEA QTHYLVNYKZTTVZDICUMFFRMTKTKZPWHFKXJFDZEO PHISKZMACLOIOLWNBFIPQRMQKNOPVQIJAJCTUQEK MTAPDHTGLLEQPMKYOLCETHKEUWCCMMUBOGCLZNNJ CJDANWQNVRRTQIHKIFGJGXGPUXEYSYIANIBPDQMW XBQVXXHUGZGUBNPGDJHJQCGFTVIZKXUONIJABYIF HNBIOESZCCWMGIRWONTEKVAODADYGGQRCGQDGFZG UIRSGMJQYLYYWNJXIRRHOTNJBXHOSVVWQDJWKVAM YIKHMLNDPPJYHWNJYVXCPGWJGGZGXYSTGUPSNFDA PVUPBROFKLYMMDRSIBFOKMOGXTVHDNUERYRQQKBM ACYQPPPUJWIZQVTRPKILXVCEPMOLBSYJMXHAVLQA PXCMPSVTOOBIQTNASGXUKFUZPZAEUVXDNXCYDTHH ZJXGNYFFDWZWJJZEORVDIGWSCKGHWWWVVEDPNUBX HAVPHHKZBUPOIQKRGPCIITWMSROQPVAJNVZOQWFF DZGYXVGAWNLADNCLLHIRFTZKXTKNLSFPFSRHEULS FLRJMEESXPBUAGIEDKWAVJTVCMASDZEUTENZTTDF RNAQDNZBOQMKASSWEIDTKRUXGTPYFRVAYVJDADQN XOJMPFQDDOJEMQJEXPJANSAEEGCNUVWBEBZBEPJZ LWTMDLYQVELFYQNMXJJJLQYVBPCTQCJEVCPPJNXE NXUAEDSAWTFFHVVCFFYNAYXFBZYJNYYXGYRZMMIS DDAGYBATLHJZSVYNYMWSGCHATJBOLTSLMLFMIIED PKIJEARJBCLZNVDQHYIDGRRCVBAAXTHAOQFRJWLT YKAMVFLWFMWFDBEVFVYWMSSCPPMVCDCWNFGHQTKB ZZRDZDXYRAAHBYGOJDFNIYVLLWEAADXFCRRXZGWC FGHYFNBBNBBHFMWVXDXQEWCESXDGIYDIDDXNXHWY JJLVOZSEBOZIIQALBHCS
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DQJNVNTSPMPYINSGUJYGFVYTZLWBIMPQPEFOVLMZ ZLKWFSLDJGCNGEJNOKSLHFBMFUDOSAEVPKCFSOFS HWXMTZQQTODDUUSQOOCLOOQZYIRYMZBMDZNTXITJ XNZFSCVWRAVRFJUOFOPMRRHPCHSTQQQBJLFDVCGV FBFGOZDVQTLPFZFLUWOAVUFYEVLPGWTPTBRFOHEY ZAZYWGDRHSCGXQGWOITQKVWOCOLZAGSOOHSRUGGD FCONWGAVHAEDRBNFJDAWYVZFQHIZMPHHPJBYREXN WORWLIWJTRPTVTLSPMMYLIJHXPBFBIZZPUKVQAYB CADOZRVWGODXWSNWMMLORMKKDXQUQWRRUJBMOZKY XXFXNDJGEWUFHZFIUPANRBCTDVGJXUCDAWVUSOVQ PHQFPVAWYGPHKBRJPIUVQKONRLGDNMRXZHEHZDBG TNVICUVNFUCWOEJXHVXWNSADMSPBULDAKIESCCVM DAAHYBNRJMOIUHIZEDMGFGMVJJCRILKDKNMTUDWL LFQYOJLUCDPMZDUVOYATQIQLSFGKKEESYDPVOPTN LWRUIRIJMBXYBAHASNEWIMYMLZREQJXARIHARKCE TIGRYKHNCQYAOPWDUXOIJHLAMLBCFPJECFYCNFAT INXZGZREQVOHJHZXYCCSFHDEXCOYWQFHERZSGYQW TULMWJTUTJUJNBKAYRATUIKSYAWYZRSLNQBVJVKT DFIFWJEYLYCNHJUXUDUUHUNEMEQBKEPZQYGTZGHL RWUAARQLVJAKISHRVFDXVPOVDKMWXDUCZHXKCTUJ OOXVJRQVWSWXSTHXFLXAYFAPTPLIWGFAQWEBFGQQ QAQUFDLGTFRTTXSGVQWTMDCBMXKTDTECOXXPYHNU IJZVCZQIGFSBXRVQDDTTAQDITMGQGCWFRBDECAOD JYUSPHDXXWYFMOFOHMGCMKLFUFTGQGJTDGEVLRCV SNNXTJBQGBGYEAXSAASNYRMELQPMXJUYCNGRGGIB DCRHWPLRRQFGHLXFGDLWLWZCTOGELZCYVJPENZFN YZRCVHRVAWBOLWFDWKFUQHGTTGKXUQPUNZACMVRM NFCULSRBKHHFRAGDQIAALMNTECKCBOSOKLYCCAZG ACXYJTCTGVAYDAJNQSXKSGAPKPQMVRFOWJDBSANI MDSBJGXWUEYPJWIBAOCCWHBVXENHLTNGQLAYNHTR HXVWYSRANTJZZRVEKPLPLEOSWJSQLDUAIQRJHKNC NOXGGFSKLFKBUGSAYCKHZZETDIXUCUOKUIASHZUK CKIDFPLMUIBHBXNHRYULIYPHIHYWBYHPVOTIVNOI BZUTSQBBMHGYMNMEYKGDBJSGPXYQMHFCUHGJQERJ GDHANOPJFBAJVNRPTYRIWCVGJRWDGQUXGFBQHDLH IFANDHKLHFTTSGULNZXHEWDYYOXGFUSMONDVPZMR ANGXFBVGSJSQPGLCMDOSIPVASWEGZGCTNFIISCPS ZEVRVLTSQXZAUCPVLPUEETOANCLZGLGTAXSLBNXR FHIDOBLIMXMAUNYMXFLZENAANGXHANXUKKVZCJRZ OKKJZQXKOMSITNMAGSCQVAESVDRXJWDIHTRKRBYZ KUOTGBAJKLNWRODAPZQSXXARPFDZCPLXPLZNTABL OPIETUVKWEOFOWRKFEPBCERWNUDMJKGZFNRFSKKO DGGSODCFLIAKANKJTXEQMCOMQPCTKEWFADAXVXKT JJLJIQZGKEVHPSMGSTCBQYYAXWKLXFLYGHBLMVFC TRPOVTQFVHZMYMBEKRGKTECGRRNWNEWXJBAVRWUB IEEVXWXRPHFBPMUHIKTBSYRXAXIGOSIKHGVEEFFF TIDZCWLDHOBJENZSWYPYTVPKCTYDHLAKAWGIEFWP NEJAJGRXGTYRJKLOUBDB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JHOWIRPMTSNICXINXZFNRQUEVQQARJKIULIKPXDQ CQHXGNFUITMVIFLNXWRHBLLGTIRMBHQNEZHCSDMT RRZUZJCYVAAWOFKLOIBOTTIXXRRYETKXEIPSIETS BUSWMJJQJPCUDPNUHBPLXVUFMWUBYGKQOUKNMHJC TQNTEXHCUXFCRDKACGISUGRHVYOUFBFXWUPQJSHS QITVUUWYSPESWYSOERZHQJROBOJBNLMQVYCIUGYE ESLNWKZJRYXHBBLGZZKOJQIMIRRHZNYSSIBDGGUB FIUIFGURQADQDWBJFLXLWCOXIKBSAWLFYFMKFLKY WTGRXREJEZWFVGGUMARHQFEZHKXERPJFQCCJPPNJ CMHNGPNZRJHQVPEAAJTPIQMAVJUSIKLIDUVOSPBM NXXVIUSVXAHOGNUKRJICLPUMDPQZSCUTIILVPCSN OUYUQGKWJSRBNWAOSJCKYFXBVBDUJRUVMPWQVCFH CTEKQDEVKGTXVQRIHGRCNCKTWCCTVPEWMADVVZKI EYIEQYRBFVNIKCYJCKYPGWBSLPXVXQHNNDFKFHQU EWTLGJROIKARSBDSUFZOHOPPGVLDUVHUXEWURCSS LNFXSPEIBBZKOTGTEHGWZZCJDJNSLNGRNZJYUUQL EJFEYGHZKBJZMRIAVBMMLYUDRKRIVTKNIMNDPTYY ESIJPQPNZCWYASVLYSUOMQZFHQVIWCKOZOYWWBBM KVTYFEJVFVFUSPZQDNCLAVVHNKPQHHYVHGOQDAWW DYQCODDHXNQXVSKXHGILTMEIXRNHJJMLPXYKGKVO TIWHTSXOMNOLPVPIPHRHBDBCZLAKCHXWKRQFCCTS OKCVVGVIHTUCDFZUWESHCANZOIPNHRKBONEZHVUY YHONINJJLCLRZXPTUGVRALGJCKZJCFZGBZAWYVGR JTFGHPHMNKICJUFKUSVKRRBKCECXQCIIOKDVZLNW JBRXZIGOGXNLLUXRACSNCQMOKWXPBWNVURUNQTEU DSCRVBQDLVGVTKFLJOQSZPIONKQXDOIPTJYKKPFF RPICQUSGPLGJHTWXZSGVBNLZBJTTSJMPSQKOFSRN AILRSPFEBOWXBWNVPCVTXVEKHNZGRDTSWJTKUEYT JPQYQIEBDUBYALPDLMYQRJBFTQUDPIYWLLRJIHXX HMIYPHOTERXQNZRBJDXXGLVBFAILLYMKDDJGFCQZ ZQABJOZZNVVARUOIPHYPSINBRFUDKNULGBZGVQDB ILHNMRNHIYXSKATIMVVFERZHGSZOLIMUZAGAKAXO IVCGLBGZSJKXBISFBDRQIDELJSHUSRYWWQPKMHHW YDGAMJYMIOHCBDSORAQAGNMNMYENLEJYNXUZODUE NDIXZHSKBPNGSPJJXLQQDCNTFTENCJGWVVRRKCIZ TGCPHDZIOLMYMHQLLGDPWVPESMLLXKAFBHBOFVAH BUENUGKWHTADGDUMWXKPULHIWUSGUAHTAOUDHHFF SOGEMEWBTLLBPUDSCZQXRZEPUDDGXYUUXWRRVUQI DMFHWZYQBZONHBBFLGZFQHQAZEUBQFVWGJCQMEZV THZVSJQWTGXAMUSQEPGSUIFTDXOBGGOJPEIDRIMO IKKMGBDKJZVQBWZDGXZYRSHXHKRLNFYCPLZUYUOV YZILVLBUFLKNUQIXCDTVSDKFGPXBHGZVIVGXFRIX VNWRFISXMTXARZXIUDQETXGFZBBHFDXQIZETQNSB OQEFOLVZRDLZOGKBZZAYIZHVJFRSWFFHZMYXEUOM HJSLQGFFYILKAJHVNHARQKGLBYIQFKWHZXDQIMAE KUJPBXGIVJNZSZAVDEWAZGWQZXSRXJXHRFTLZDWP YKZYCLXYHXVAYUWPXCXRCZEDFBZESSUXFHNGYOXY CKZJXKYSTVJFNRGORKSC
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WBOCPUXMPPLQXPKCXIHELHWWBMSGACSUXHTBGPCB AQCFIZBZWCGPOODOUUJRZQYFMIQGWIXXOXCOMGJV FYJYZKPYKPPIVEFGIEZRRQHOFMCXGYXZMHAXWKXX NRUSGCRBKTPTNRLSVARFVOVPXFOQGZIONBXVMXLD JPJOEXTHMCGZPFWFUBJHFFSWLDGXHHXJRYWCDGPC PAYCWBFSELZWXJGOOWPQLPFBFYMOCVCOKTXPJTMO TWXQVCEFFIOXKWXRQXLAUQAYNKOIXXEULYBUCOJE VVMUMNNLXHHUQRRVVWHMKAWDDXXIPGWWTINWUHHS BDCBRCRWGFYCEDXZNEXXLXUTTNWFOGSUJDQGWNYZ HJSRLMFYUBTXZKFYVJWIGBUSTHSPIKUSKOZUANPU PIDQODJCEYZRKLZUKZIAQZJBTLRDWDBBZUABQVGG KZIOGPHQDKAUHJPJTPBGYVJJIMOHJMZIVLPWHKOK TZMYWWOEAPGZLXUSVYQQKUJUGYDFCQNNIAOJZMIO IENQQBHGKUGKLAAXZAPCNOZHZUJLSYPNLCDQOEJR NXHCLSFLQTKCKAMNRWNTPWIALYEUBBIYAMLJAJEA THXBPTXEEKTGLBRYZBIRSDLMTQQYFGEYPARAVDYM OJRSJIWIEOILULJOFJDMGFKXIQTBDYPKIIQRFOSE FPFORAXNQEZXFUBCSFFNYPIZQDVIYRFITCESXXJQ AXMNWZHZSPACGRDQQVIPSTJRQATWURMXRLYVXBPI MPEPSNPAGLEFOXQZJAVCAMZUWDPUKNNNGYYUPCUJ LYGLUFTXUUKLKJXQSMQNAOPRWEMMXHYPSPHQIYXA QGYMIDSVMKNZVDDGBRCSPHUCKAWGOTMFZWGYNZQZ SDLTWPHPCSXZPNLLAPQUGLEZDQMBFOVCIADNKPNA RLRGTTZTOIPYRHSCXWPPTNIEZUWMMFLWJRZTPQYU PRLJDTWOSCVDUYQCRPZTOYQVIYQYJIUPXVMXERYC OIXUJUGKOEKDDXHQVIPNEWHWYXXKMVHXISDMZSCV PRRHQKYWBUYANTXIITHDQGMDGSLYVWQSMTBRTKNZ ZMQFREPWBBNTRKBPGEFOLTMSFCGINYGSJFBCXTSO XLEWFZOYEYYZXHCSCCZWQRRVHZWFCNMEHIZKPSCA UZUKHCJIRSEQQSNYGIQZVYQGJZSAGZNMWQYKZINE YOZGNKWHFLWXLJFZHBATMAXBNOCLFXVWKFIVWJIG RSBSZORTMKBBDMAVJSRKJSXBJVDMLFKVECSPMOBT JWNLLMDPANVIMBPFHRQDVKSVWDUSJKKICLSTSDZB JCHSEIACAYKTIRXBQGQURTQAWLDMVBAPKETJCAGF KYNHTKINJOLNQDMIWSYOTDPOZKPFLXCRVNHPNEKQ KXDHGVHNGYFFXMQFUDQQXUWXYFIXGRTTVOCGTFTI LYRFTXLMWIKIMHVYDABPYVGWBVLIAQOLCOHQMWNQ DLJULPRZBHSZLLQJWCHKJLDPALFYPVDJBCPHOQSM PLJLBELKCRLOQBBCCCLJDZVEKSKXADWHDEIZNFMM MEPPTNQQAIWQOVCYYADLDVSZEIFWFAWFEZWUMXSB WIDUDFVFXCLSYRKBXZUJZRFEZKXCFSEETMPRQHFT IMUROFNBENAXVFUNSIIPQTEYWLEMYNVKDFTUTZWI BAZVVSJARIROKBSURHFYKFIZGLXUFICLAXBGAVJQ UHSURBFWBDENBIQYJFQBZAOYODTVXLGNRPAEREGG EVQNHWVLEXBTMSZABGVKQTYCTIGTYQMYJVJNUIED YJNNBSYHAQSRFYXJCNXHMERMOZHSVUTMKQSAYJXV KJWQFBJITBJEXGLTJVFTVYPRNHENJVXABSTMFBAJ UYQPOBIUKPVBLXNEKBIU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QFHLMRUADSCHCSQLXVTQENSZCOYZYJWOBFBSLLBZ KTJLKYHOAMALWWEMXUIAQATFLSMTHXAXHMRQQCHU MSACDTUUXRFBKOAPYGDKQSHSKVGTCKNQZVGQSXOA NNGANJBWFFFTGPCNEGRJVFOBBQYSKMOWMHUTIJHD CFAOYHGGIDVBXWKGMZYDSOSTQBHAHAMBJQAMBDPM SRQCEXROZVUPQFJUMDWNJPEPYJVNLKGWRYBPLARN SEQQARUTQHRJHTQGQZDWALJJQXREEJSYFTMMFXPQ FSCGSOYYSBVHQCXZAZJXZQNPYIXCNJONARHHCDQB ECXWMMKUQOVQXXERGHHROXFFVIENIXQDEARAFMNR SPCUEAPYFSQKNFJHZQAITWEGGEKNHIAYSOOITBJK HLFGBYORHJZLUEXQJNLLRCDUFCMSLCLYJAHBLMAO ESANHTEMTVTAOQEPIRHEHAFDEMUYLMLWXKOJVBBV MMLGHPMKZXWLTAMQWDWVSKGQOXGZVXFEGJXRVZLR RMJMQIYHVGTPZMTUQIALRZPKLVEVVFUDYYLOBAJU UMTEKXPOMDNITYONTKEWSYURBVPHQUPMCGNEAQUR WWQAXHEQKGBZESIEJKQRWGRWOKXYSNAFMWUMCCTD ALPJIGDFIFQPXBVNYOITFQOORPGBOPXVYFZAFJLB QKXUCOWCONONWTZBCSXFAHUJASAFHSQVCRKRQSTO OVVWTFXISCIVAYUHEPRCEHRJQWJVLJNMEVATVWKN BFIYRWCUMIFEEYPTAIHDIDOPVPHFLKCZYDYDFQHE QQBAMGMOKGMLZFZRWQYIROACHXTNPMIIPEPEBXQQ STXNLTBWECRROSIRSLJUXBCHDECUWTEHGPIYFGCE NVCYEDIJINQYFRVJBWRMCRYVMCONIUZQUUBVZHDX IGDPCBJVQBEWMFIZNLHITMINJXZBTXIWTDPJQXXK HVDZUBEIKJTFHDQGVWRZAQLFDOZFDSAMKLTBSGEN FNOBJHGGQQGOZIMLUNXHELNZHCDFPPFUNXZRLGHR VIIGFGEAIATJICOSDWBHZSIALFDTOJDPIRHWGYEU EOIBNJFMGIIMDUUCOSDXQAJFAKZEJXYGLRPILXMY TXJEVSBZHJLRYZZVWFARIUCTJUHITHBESCAUEQKV MFPMRKKJAQIIYVNDUYXUQKLBYJLOZEISTADDCUWK ROSGOLGOCEKYZMVQFNYFAEOKDDGDBCZTUHQSMASN ZHOBWOJPEZPPOGOKMZKFBJNNAKMLGOCRCHZAJGEW GBWBLVZWJQBOUDYHAOUQNVBINQKJGXNKBRCSYRZQ INJMZHLVYXKXUFRTZBLFNCLXDRCPBRJARIRQTNAU COXZMONYVMNQKYOGTVLVGDEZNWQTAJPULSVCPEVF IGSVGQUHUYYFXRRCDPSRBGLPEOFVGMZKBIHWFYLS DPVJNMKQBBNGDMMYSOYGZAOCMJMEQHXXYMRRGNHO CMDENWMKAXIAVXHTMGZZKHAFUATAGWDNNEPFSPGJ VUJZHBJOPLRSCZYWGYXMZGUUXPMSVOFVVNBESUZP BXTYFJJHSCWDWTHNFYJMNRVEPUNCFGOWTRWVCCHK IHVJOUCOUEUUNGBIKKSNZQFXRTRLLUMVIBQIPMKV QOVLGNCNEOIERKNUXREBHJVJHPWDOADMWKITVPJH RDNOTDHBJWNCTTJECUHOOWOAJOZYXNFFIAXXGOBU MASBUKZVRFYGEXRAVGEUTAQMZVVJRQYAOFASIEMH JXIJJQNEEMLBBIWBDRSJTSFFHZSVNMARIVSXVRIZ ANZNLTLOHIVDAVRQTLQIPQYIWUKOLIECIWRDCAMU APQEWLBKPRFCDNGZMDGPIHFVGHQATIVUWFHEWUZM ATIUDPJSNVDGXUJQSORU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NQSETIIJCARWPCABQRZHEQOKGZHGHIXWVZDBKVDT CLIAAMBFUWBRMPBOADPZMWTRWCHHNJZNXEDPIZXU JRJTENZEBOGJUYUISGCPAJYXXJANCWJRATOIZVQQ XCNNAKNIXDXANNCTYMHLAMKYBZZWQZMBXITIMCWP BHTWVYZMUIPMIJLOKYZBIVPIIUDFXZCNEXTKXNMG OXMZPIDBGULUGNZETSZCWVMONUERVLHKOCYJTTYB ZNYYEGHCCIXAPLPRVAJOIMWTVCCCAFMXXZQTVXLV STPBLIIJWZHOHOXHMUDQVQCOGGQEGVNJVIFGDJOV HNTODLSIZPEDYROOWRZYMMWURDOODZLZZIUDSEGN JRVULDXRPBVTVVZIRBBESOYESANAKWZWPCWMTUSX YPAFRJHTHDXRZMBNTUZRUOPRYFLSMEAJMSVRQNIX VEMESNFQXFBCKICWQFWGWMIUNFFAJPZOJGRTMHZA ZPMWVQMIYECPYZCYWLXLMHCYMTYXEMDYGMQGQRJA GVISAZQREVDKMKMYLFTESAVCKTUIGZYWNOVMQWCK DTLBJYQEFXYPHZPNPCXXIBSOAESSKBFOBDMPNNUM EIJWMATQMJGRBJVAADSVESVETGDOPZYKNZXSBRHP IXBCYSVQQKJLDRBXAEJJJPSWOERDXVKKHOMYYLLM HRBRXZBZIAMHPCTABNQPPYYQDVFUWREVEXQIQSTA MCPBQNFJLDOMKHONTXBCRNAZAMSSJVSGDDTYCBPW EODMKUXHNERVETKNSPNUKDTYVLUHLZRHPTMRRCSR HFCLNBHHCBMONNHVJCXUIPYBGVRDIJYXTFYXSPFK IQDAEPGWDFVSLVELFGYQVJVMHUSTQFIOCCDVKDAI MZTXXCSRWBGZUUGCIJYGMQLQHDRHAEZLBBZZGVPY CLBNKKXCLBLFTTDJCPWIICQFSIUEJDALAIVMQXSF XNUBIOBCDSHHTXEFGQNNWDJCMJMEYQKHARTLNCTU PBZUYTAEFANTLTLAUZBSDGQQPXAABIPFTFDPJRUC IJNNPWSDULCQHWFJUMZNIQSSFAYGFGZYCNEGOSVJ ACHCXXRVANRXUMARIHVFPRJKVOLDRSHYTKYCHMPV CJUSOBFLWXRXVZJKUUCDJPGCIXZXVXLJWAXCPHMG PRJQHFWZIQTVCVLNMOTSKUCSLLWFGBSXUXOQVGXH TPSLENIADAMYNIDDFLROKEMHPANMQRABIGGOGPWX TGELOETHTIBCRINLRHDFHEOGWSPEWOPTIWOWWUNT AOQNLJUGHRTMLAZEOZRESWQMRRBSNXBEHHYZRVIO OBHZNITYWKWGVUCQIGGLMGAKXLIBEBPXDUSIAEXP BHIDAFVBGPIMTXXQACMWWKNPPBFVEYDJQTLPLJTB QJWCSLOHTMSGXRJOXOEFJACEMKFUVBHNWZQESHUQ MEOAVZUGBYXJOESSXZTIBCLBVFWUVDRSLPSWGHSB PCCEVOSFVRLOTDNHUVIBHNYNZHTBHRSOSWPACRAF NUGJYCUAXJTMFDYJGPRIVJISBQOOFXDXEGRHOBVI DYEBNRGZEKVXKLOAUZCHZGJMXMHVIFBEZFYLMQAA IQEPOQDVAWEJEEYQKNFNDZOBWEHHUFZKSJXDIOPQ SFCNFCPRVZNZAOVAJGCMHXQSDHYUKKNJKRINDWNI BEIGSPUTUVSKPCGEXPASCTOJGPSZQQZPYGWMLCTF PWIHPRWDOXZJOPLCRSNCJPKCHFLNFBLYOSPCEZRU ITTHWPLQSQAYCTMSVOWMDIMVQSPCSXEGDYSELNXL GUJFBDOILPUNZHWUVIQAMSHSGPBBUNSCRZCTVAZY MGCJGOOLGKRVAHTMMGBCAJTBLHCOFUPOCHCEJZAR BYPNQUODQYSJYNPZIAER
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KAWDRMIKSQQIXKGSOEOACHXAGGSKYUDOQNZXGDZZ UZLSOXNDNILCLRSDWGJVVPSOGZPNFARDQIFXWHTW YYLJYLGJWEOREOMLAXEJJZOFABIQZPOKBZRGTUNJ QZBYJGHIJAXTFOLHQSHPJEXSZCROJWFZADZVTWTG BZHMBTRKNBLVQFYFYJARPQAFYZWPMZGMDCZYEGAP QONNBNAJUOSBHKYXTRGAVNIRLONVLLXSODFXZWHW BVHJBTBRNCNRRAYVEVTHXCSKDCGJROQHITIGRLSF LMHRKQBIEKCKDWNNAEGQGZDZXQLKHBMORMPECXNJ WDBERZSZEBAKHTKYMMQSYOBGEBGLSGYVZMQLXVGA VTBCTNIQBTGGYYFJRKNCLQIGVCUMAHAHOFMFAUJJ COAIEGVZHGMQAUQMMKBITMLDQTUYMNAMGNNVGGEW RSZZZDYCZBZFTNJTHRZOCWYYSDBHRCRYSMIZTBGD OCNYLLKTITNXNCFVDGZHAVWGGLFRYSRZXZJKHUFC MFMDSLVVSDMJGBXUGHGAUBCKKPXJRREWRNQBFMYK RRVKYHNIQDYQMZCFAYJGHEPLCCFPZTRUYASVJHWP ZZHDFGEZSCCHWWXRXRBIEWRHHNSHQXQVXGDSDTVG XBYDXBYSKSVBSNUEHJLUQEMDYGJWMPYMOMRAMVIM YXBBTBATLFHRRBPTHLGLZDDWXOIAPPAXRDNVBBXQ CACBIOSIJEJUFIRAJIKLWBNUQOABSYKKJKNYNELM KZIXDXJTGPMAJMJYZPQHYYOMYBPGHMAAYLPEBFOB UPGLVQCSECMEKPMXBXJAKMDMWSSJEHFVPVAVTCIV YDBICEZYETELIZTPWDYURYXLAMQPACMTXHNBLNDA FZKXQGLQQXSGORZGEVSJVWWSORYHHIVDGDYHHHML QGFTKNHAFTYCOSRDRWDNIQQERATWMOIEORIDJPLB KQDPISWCOHUUWWNMFXCMKLDOQWOSZBVWCSBMDVEO AIBEGUMUJXBCVMUKFDSXMXUYCCKZZGJHUEZIKJWS BFGOYTUZEXGWCBZGHTUFAIKNUDAWJCMIHGWVFEAA MDJXUXDBHHOPCECRZTAVHFPOSCHGPPBSSHQFWSWE NTXRVYWVPNOCPIMDOEXZNBOMJTKBTFBNRYQZOABW MFAQOXENUXLIGOTAZHVUAVANCBKCYBVNWRPDRGYL ESIWCEHPNCDJZGCAQNFTOOHMXLFNCITDQPCLOCES EUYNSURAXVGBXQZVIKIXXQXFZAZDJMBSQIOJRRDO UGCHIYFYGVARHAMHEAHFIXOTFYELBNVVOAKVLVKY DVREAJKBJJIVQDRUZVZUUDEAUMASPUKJQFTXPYZD HDGYFIDMOHLLNHJMXOXBDYRIRDFKSAHWGNSAQLZO CTMXXGXVGQEFKJPFRKTTLUBUZAIGYGCULBAJIFHJ ZURBQXEENLTCGDWUDOYQCEXAFMGNWRUWMKMFDDWC EVCVGLEITMCNMKTBQUMUQCUMDWHJTVRDFSMMFQNM XSUCFFLKCDNXYCSESWLFCMDHUHKVPZXHJXMPXUDK ISJXSIJDPWKIICYWLYWRXITCDSUBQSZJFUBQSAWQ SKHRRYLEELLOUEVCDITKQZUSHESCJXTYVZWJZFKQ TGAFYTJYTYXTVFEOECONOEPGTXNJAWUUGVIRHCNB QUSRELIEYCORHWCBSWDIWUOSWJWKLQSNIMVJVYCU MRKEWGCWGFSWQSHVEJWIXBHUHOFUVBJYZLGZQTOQ KNZLWIZTBNXASWQCOMEDAQYNQNCHWUQJLWSNASBK VPYPFKRRPKRGGTIZIVTXXGNYTOKOZLYAYZIFHLDD QMHXTMZVXDVOSLGDMPZWDIECCKFMYMQDODSBXDLV OQIFNKBYXRICLZGUNTGN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      CACEYFGHPNRAFRYMTBNHEITRKKLMIGDJQARNHYHN CYTGLVIDAXDDKSRHXBHRGFDVBWICTOPJJFNGDAUB SJNWIFHBUROUSDDCIZBKDLLRLZCCCTEFVURMFMDL EDBSOIGKEMRDPXUBQMHDNOJECVGGEOOIUSDLQUTQ TWXUNPUYYMVDQNZBEHDDYWCPBPLCQRRXWWEVSYBZ NLQFPKHKSGBVQNYBXUMSRWMVZVICETQHKBKSLNYM UYWFIWOMOPIKPDHLJWGSVLHRBSYUTCTDKKTQEVEX TCVKTXIUZETFGORYKYLKFYGJTIHGOTZEMXPUIUSA EGKYJDNWYNWQIBFGCOUMABWYVAZRKQCLNUWZTIPF LHXQBXMJAUUTUIVXTTCYGDELFIXMKPAGOVCEPCHC NIVEJDGWIVCNMIUAQFQYOHWSGWMYWZIFOPIMXEJY RHEPPNDSWQDPBYHVVYPZMTYKHYSIBOECNGFXUNYQ SULQVWWMFTQEBBRRBXOSAUVTHEUJVCKIPSZQDQVQ BVXHJCRQYRDBFGNDADTUFRILQYSFOBHZMKXLMBVU ABAMUCWDTKANKYOVTCUQWWPUMDBYBWXSBSFNKCTM UTPCNFGTEEWCMCUNCGMYUZGOWRPFVOJCZKTDWCDR NBTKBEUDHFAJUALPTYBQOLMSFTNGGQLQHXPDIAXG ZSZWXWESICLWWCENBBIMYQKHTRCXWTGZKRSECNAU NLFQLYZOWWZCEIESRYILVUDVBYORJGBIYVYDEPRV NQMVZAJPVAUWRSQHDOBHNDFLXRZUSXNOMUCQHZLS QLTQDWZCARRDFUQQHVJZZPJMARYEAMFQCYMVCWTO DGQZLHOZCOCNSYUDKDBJYYJLYEULCHTDOFSVTIUP GXIYVENOVPOFDZWUADTTECTMVAJMBHJRIUMMUHFU FUWWQEZWHHOWJARFWIABJUUTANBQIOCCYGUCKNLN KIDSJAAZOCBAOSVNBEOUIZEJMSLLDFNRGZYXUVKC DMKSOUQYEYFVUAEEHMMGOWYLQYVZSRXIHDTZEHZE HNAILUEUJSOBXVUSAWFRKEYZHPRYFVANVEAFAUNB FKWXPIPTYKYOFURASJRTBQMGRRCPBUIEBRKYPGHR FOYYVQWIAKXKGWQPWPYERTENHHWOBPQCJDYVPNPK DRZPXMCMAANTXBSDRMFMYYYIFYJBZFBYLWERPPDR BUZNEKINVFBBBOCLBQKENRNWYGZOEIVEPJNSITGH JENWCFWZRFXCDZLTACQKVHKGZYHWVTVGXGZWCWAY HNGQDKNVXFMFHLOLOALRLMJCRMMXUJLKQPSEWKXP EWJVBRXSBXXGISEJKVDBOSDPZBKLFIEJAQTDHNWP MAEFSMPJNHDBPCUWKJIROURWWJULEHNJDRITGPKI TEBSLISNOWZIXZJUBLFWKFLHOIVTTQIYLCLUASFI DNHFSCXTRUKGIDQAOGWQHNDZTNLJZDTSICJNLYVV EPWPMVEOQFTWUZVLMQNQOBBVJMJFQAMCHXSKTOMC VFPVFVXEGFPNQWJYJSINBVTNMALMBOKQKCBCMTYB NMEKOZYKWCLLAFUHNZPWCRBVJQVBRARAMXPQJUFM VPUHVIKJZIRWEKQWDGHSBWJTUFGWEUGMQIKTFNSD ELHSNCMKQGNLWRDDRLVTMMXLGHWNWEOUQVPUERKF ADBOTMTIGLOJURPCBFBEEPFNYOYUUZMZXJPYBBVU BEAJFDASDSJUHUEIHUDZZJQPSXCESXBKUKHKWCMY IGSDIUKSWHGKPGXUDGVTIUSSDAQBQRVCZLDJJYBS VPRVADFGNXHGSPVRBPZWFUFSFBNZMRFMHGSYGYRY JLYSAKRLSLPITUKOAVZUOHKUQHTIFEUKNZVLUHDU UCPDUXRYMOITRNDWZKER
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TBILZPYZDVUTPTNBGUHJOMBLVHMJPIWWGZPKLOTF QLAPADJHDLGMMIMTSYAINSYIRXTXWNXSCSRDAFMM VGASLFYAWJGEZMBPOPUPIAQOPQWNHIVMJZHRLVPL TEPLPJWULOVBGVLKHMKXWDBYNLQQZILVRLJQVYFT IYESGPSJWQNFMUDQQLCDOMFAFBPRJPRHIQROMURV XRZRVCSOVEJBHZOPYIJVETKHLPIZYODZXXOTEJAH KNYCYCQPPHJHMRJIYTZUHGNWUFLZRLRFMSNWRVTM DGODMQPDOBVJJVELTVZBESMXVWULRCOFGRHVWVFY WMDSNMBKOFDQZSFSUAOFMGQTYDJLRRHOXZOKHLDW BOZTUPRHSTGCFGUNVRENGTXSRHKKEUWZCZNMHVPM ENFGMVOZLLRUUJPLSRCRXDLIAZZJEOBVSJKMVQHG ODZKCNDNRQILAZHNUFFAJYHAFDUFGCOZVESXUFAJ BBDNDXSYRSEENFFLFMPZUQMIUBWQXKYWOIBABUDB YKNFJVGXBLFEQKDADMORRHWFFKOOFTMQPJIEDBOP XFDOJHNOEJDNEWZNRAMVHVJLWLADTEHEXDWHHRID IUXJMJWKSWSOZUJTVWVRTMTQIAVMSYWIRFITJBVI EFANBEFNAYICJGUCARYOCLIINOSUXVXFRWIFGXII UKRSWVNEYWOKCXPQAXPTZFWRJTYJIZGOVOZQXRTX OVHBMMELSZRWVQWDBDIXQYYGLWKBCLRAQHFQSVNM LXEAHSNHWPYZYCKIWJUCDMAVVICJBUGFUBHENIWX QHUYBAVEJKNNWBTVFEQXSYJGMMMBULCLGWSLIQFY EOBLBDNVGMRBUMTLWETFTZOTFQKZSLUUKWDTPQAM CXBBOXAJALAFCSDQCJBHICVOXTEYZIKNSKJVPCNN QABWLWCLSFFNMABMWCKTLYHLXACGBAPGCUXSELHM LNBEYIGOGGWARVKSXNXFXUUKWMCUVHVYZUZPHZUX MBPUZHETCELVWQCHQPKWGJMQDUJMLSWXBYLPOFZZ PXMMZPXYJLTROMAUHEWFWWLTAFPKOMGAQQJTGINL TBBJUNRRXELROLZUEQOSDCCGFYLEZOWESOYTFXDX WBYKKKXWFNHLYNBDDHUQLXNNUPUOLIQMKESEUSGX VHOEEJKOQPOJKXVQYVKTGSYOJZJKLOGKITDQHCMV UEMMYFFLCYCHDQWBPLTWDUHCVDCOLLPRFNXLXHFG OESZGYMGWJJACTAMKTKWRCXFRKLGPBSZESDXLYJY IYJYIFOILXWAURRUBQYTGDOZSDQJKCJWKYHVINUS FZVMAVJOHJRPDIKWVPCPFCISHCGNYAUKXFOROMUL VLDLVJAPDNEYSZBZIIVJJSJMGGUMHQUBDQFATGHR FWFWDXNZVMTQWRHVDPMCARBBUQEWKRDQBPUPEQYM QPWJSOPNNIFYSPVTOZWWADWVKFUUXJWQGWYRGHKT ZIFYJEQQSVBCAUQZLXEQIHTSFJLUPORKJQDUGLSN IZXVEMXNRWSMSCSUAZFWGWPNBHAZMCTRPITVOLIQ FNHTDTOTTLDLUIVCTPDPXYHFJCZPOJGQNZEJBXIM ZCIHJWPNIQUJGAIRSEIJRCCOLPYRZIBFIRXSAUKY MJJUVNAKRIBDGXGAGXGSKQGBQIXQQLAJTEPBAEIA OWHGJUGSZHNCERUKXLPQMZZKEJSGIGCCCTECSVVK VWYXXWDSTINOFLHTGFPWVPZNOVBGOZGOOPDFDSTL KTKGFKCGMBJWVKKUBPMFZKUVCSZQSJLXSMJZEGWV BGJZPRZBSTRJJJKQLBMHIFCVAYQAVDEKNQMROUWJ PCXQNAVYAJMFPVECZMJVVMCGYVKLKZJIQPMDSIQY WFGDIPEXKWXTYFOGKCEH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TUHYTKUWXEPJGKUIZKRHYUASOZNRCIKJLGKNVUFJ UNZQTROIVSRSTEJEFBVQWCTPXUYXVMWKVTWOWSPA ORUNTAERXFQRSCYRAOFTXZDXWJFFZMLVMPHJAMNW BKWSEZGPLTXCNMVRUGSMFWUYXEYACSVMDVYAXARR ZBXNEOYLIEKYLBKGVKJAGRWODKOLLXQOUSCZMTKE QMFPUGFVZSRUPPOAQCHGIUTXEKYADZCNGEAFCESF VWGIULISFIPCXUABKMOTTLRRMPIWFETQUEXGMWII HNOUZJHPQDLQDREWWYGYUBTLXGDOZHXRWOWZLXFM TXSYLZPYKPVKLBAZKKWKXXXTRNVGRLHZXSXALDMX ENPQGYBGXKJUALJWMHMNLNJJZLVOHAXTMJFNSJFX REIUGRQOQLWHWWNHVXWZXMZCYCYGKYZCVEDKWKMH NHGAPTLFKMLMKQHKHGKEBMWGWKOCCSOXGWFKOPEG AYQANAHBLFPBOPSDNOMMPYEIXNJGUZZKPPSXOYQZ YDSMWFWPEXILUGAWTRNVSAIRSXFBFKPGLPUTRAUR LOYBSBBODVTIKOAJSXMXIBGUJWGZRIHZFPQISPKC UJRSVTMQEXEHZACFSZLADOWHBUMKDIDXYXSHIOLV QXRXCLIVBOBCQJZIZEMHCVOPNYPJZAOOSTBNLBPB NKOQMEFRQPXPKQWJVBISZEYJMHAKDELBQEZFXZBM CCQPHXCJURHAEGNVFHMQJRCZEVZAUVYAXUFSBCSU JCEUUPHERODVKYYUJQTBHLLCGWJOPSDCQHHYFQOW RCDXIRVUROAVBWUORYMHUWDFCJHRRVFYPLLXWGXB YFKMANXTKZIRBOTDHFNSYCWEXMGSALKRSINHLNXB PSLDDAOQSPUXXGZBAYSPTNRCYYEEFXGFKOOXXJFZ GFNCNUVSLUSIXVBWKALNNNYJICDSCEYTFNSJRYGA OHQJACYCVLEKTCGAQKPWBPRFFGMOXVGQTMESOUVH WKHRCCWFTHPFRRZUFTBFSVNFSWIMNZFUEWZIADXK XBUPTCBSFSUIGWGZKPEUGHKSQHPVLTERFAAIXTCL PVOSUDYOZVINWOMADVUTAVTHYZXGDSHSPACDFYFS NHLJPUXNGLRTDTBVUGNOWNYJUGHJYECPVHCJUQVH DRMUMJNLFSITQTARBVKGJUVOKFLSWGEEZAEQHRZM CSKMLGSPMKZNNMVEKOIDFAODMVDDHPIOXTFFEQTE NFOQOWJQNISHWZJMHXBRQEGUGYRVDEUYOMARTEPU LLDYDDLXWIIOGDDVVXYUNVGQLSBRFBECUMQXQEVO WPOSJKVXZBIZZVBGNDLSXEYIQNUBVLTPPXSULRRQ NDAFOICZFPOMSPEYQZYTOTOCLOAFLEYPGMSABMKK NRCCSXZALHNYZATCIBKHHWCPPSLUCQJEDHDYYPBQ NPPOWCQARDTTZIGTKSXNDSLCVGYROMQONZRIEDHH RODJHERSFBMPITCCSIFXPRSKYIFRPYTHHJEOGPZR KPECHIEQIIHHPOZUQQRAYLABIUBLLXTTPDYWILJQ WEVDUJNMEZLDVSKSWDFBSVVDMXXSMMNQLBDLKZKT YJQDOVEHEZIMMVQRJSFFSBPROQLSOPMCNTJWSWCE AHDXESMHGXEUAKRLTDXZYKPURCSBBVODYXHNQKIS NSUEFZMDWOILKOBZCHLVPLBDCQSRNDCUKEGFJTOO EFCKHNQJMOLWHZGEEOZLYVOKVCJAELOMEQSWSMIJ DWKNFHBHCUEYDGBAICGXNDSAAEIGMRVEPFMDTYZB PMMFAXDVAZHORZZSQQPKRBAKDIZSGTNXKFQUTDMU KIFPFMZCNGNDVHEDQMPTIVFWDESQPRSPRMKFLZNW WCEYOBYNAVNVJJWUNVWF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TKDNAAASLQUMQFLCNODUSVDIVSDGFMUKSMSOCOTE WIZZVBYSDCKQYYSBXMNJZCFWYHDTJBPFIPEFWXRE WGBCLZCNHBTRTPIBUHGYMVKANMBSMVYAMEICJHPM XEEAPCKBPZRDAJJSOKWBXXSSNZEBGIVQTXHWJSUM SJQAZNEIZZXOLZLPZOZEEEFFWMESHYPORYBUBKER OMRPECNNMJTYZHCFHSEHQVLGNODJZDMTBKVURFFB YSKKVJGFUCOZCOOWJXVHYXHKCBJJRBXOSJLFSQMI MTLTASWQDXEBNSFUMOPUXHZJPPOGJYWOZZCNZMDY QLUBLFSQQYVOBTFSIAXAZBRYNONZIVHLDAQGRXMY NMIEVTEONKKAPIOIMJWITUFWQMJZHENQFDIKTSQY NXCTLTCHJCOWJGWIFKAUTGUMJOQOYWSZEVRAMZHZ KEWIQQJAEGGQCTVYMTLLVIMOHEGDWTNDFMQJWNQD COPACSJBJNEDRBADVEAFJGUXBYZGKMGONYNVADWZ LAYEPFXDZHUNPVPBIXDQOXTTWLHGVHDTYKSVYFLM DTAWJHWPLGMGONXQMUTGCLHCNFIJFXLBDIEIHBIG CHTJTSVAWPDAQSTRGABWGPYESAHUKHGMKONXPWHW VMLVUHFJBEDKNCCNQXQAULTPUJRNDONLZLILUTMR XJQYSQCLFNKZZQPIMYFKLZPYHEUMDBBMKRYOAXEK KAZUMLDLFLUYQICTNVEVZRUCMNWGSPALDWDEKKQL ASNQZGCYIUPTNTEBLBDXYNDSFOPOXVWYWPINMZEB LHBVUVJOVUPLMVIQEJUJCUQBUHNAAKJKJVPJPJTC ZRQYXGXAUWOLEAFMWDUMNIWYTUQWZDSVAAFTVIHU HGOYPOGXLKGNNPMFNEIESWHBJFCFSJCXLVESGXIG RJJPISXLJOSRSPQXLWPGGJCUZBCXSBYTJKCLKHGW CCURQZDISABEALYYPOPFHSHTMDINTWJNWZCYZPMS HAGACGYJUISZDIMCAMRDWGFJWXGELVWCTIWGEYXH BUJQBPWKHDNEZSKVDBRTXHQYOEKGEZVUWSLTQOJT SXRRRQENGBEHIZFTRLYZBLXXMMXJDQVCUCTLBVCH YCQIUPMILARBZIQMMTEIGDCXZZTJVHXMPHOWOWCJ MWQDDXTWNDZDSWSYZDLMXYWVLJYXRJOXUTKRNCDC VBNTQNORMVZEPIQLRZXEJKDRDSDVMSHMUOFAQLQM OBSHGZUWIVNIWGDOPIRWJBBEPMPAPMZLEIKZCPFJ NSQRVRTNIDMTTMESBSLHQFNVKKACHNNMDRSVOOEW FVLDAKLEXKJXFHNEDJKOCUYAQHELKAGLTABHPYGV FSJQDONYGMEPQMGFCNFEACQGCKYQFPDWDXOXRANL GIRCKQHDXFKAQMARLKWPAPFHQZJLEOJWIZCQWBGO GJJLSSKVJEDUHRWLZPWLTYPWQPGULCEBOAMSLAUI HJNUZRQAFOFDXBEGPDKVTWCENWWPKLSZQKJFJMWS WZBLFPGIVXOVOURELHPVHUFBVILGTQTEVRHQFKCD FJDHFUBBVQZLIPFWWNLSJKUKXQHZTSWBRNSOCYYY EXAFPWGYJDLCHJQMFWZJGUFIJPGNRHIRKGWQRTWS MUITLJRRUEPMLWTDFIBQMROIBQFDVKEKOXZMXOFO BEFIJVAGBXYJUSYSBOJXXONUNINMYCGTUORWEVIS ISBKKJIZIFAVZGCTBBABVIAAJCAIWTWKOTXGZIKO VEDFLOHLJVICFVHZRBGTQLLULPHXLJFXPPMUDYKQ WQZPNZTCKNGTIYDVKPRSXWJLAEIKRWICVQXUCMCJ QUSGVREWXDWGRYCTKYEEWZZRFKWCQIGWXIFMETJD IARFVLOIOOXMLZCCEVGR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QNQQPCVQIVPFGKEJGOKRHXRSOWDTTZIJJNHDCTHW JJITTZTKPEJARTMYUFIFAWRDNXURPUKJXOIGSHHK DZDFJRLEUYNNSJOGLOYIQBQWZUGFSORUGEVHCVMS XETHGZMNYGUZGDCNGKZLFCVNZQYEEUOZLJXNPIBU JYDKGPJJQKTREMCODINNPTYGLIOFURVAUDJPUJYF QENUXKKNUJMQRARESKFXWILYFIGRLMTGHZYZSJCH MYTKNFWHRKAZQFCWAXFCQKYZIHZXAZFHZQXDKKRU LONCLMFOZVOPEECZOVXQIQHWWRGNIZHAXFATIJFC YLGDPHIEPXUGRGJQIXRZTRGTTRLOYUBOIFDTEBET SXOCSAVABJDGJWZIEPNWRGFCTUIVYVNIABPXUDUI LPZUFHVDFNZTNNDUEMIDTSUVAMPKCAULVAQMAMXQ NPIUVOGOCIGQTLPRCRGXRJJGOGOLTKWHLBOJXASY YFNLTMGHINMOFPRMZDFVQAAERNJMZKRVMBRRDAAB BIZQXKWUFXZVPSBMZNBVCDBNGKGNDTZXZNHLAZMJ XFKYBDKLZNRVZTPRHIWCGMHGHJCXJGBQVCOPLQIB VKURQVVLWKTGYCPGUIJOWXSZNRVQMPUCFEKRWSPX RMQYOYFAQEAYMJAASUFCGEKYQWQFJESLAEYXZLUC ECRWWBGONILABJAMLUGOQUMPDISIDVXWTILGDXRX HGUCCQFGNHVEXNQGYRLCSBCCZTWOYNSXTUMOFHDG EQNKCVABKQOYCQJEWJIJPJYYMLNZHOFFPRCXMTJO LMZKDUOMMMWJSKJPVUITZSHPSJYNMKQDWOQKEJKN JKQJJJDULGQYFPGDMYORCZADYNFLAQJBWFKIUXQO EZIYAHUQPSNRASKWTSBCNHTFSQQBMNFUBCJBIWAF VFKCTEIWNCONYTBQZFNBXUBFZNZTGYAQVFZDWMKP XBALNEAJVVUGDREASCTTYZFDGIIFTGOKJARWVUQI MYBDTGGTZMDHYESXENYXAULWQEJOSCQYJRDCQKRM UGYCIAACIKWLWJJWUOLZRERZJAOSTQJJOQMKREIV NTCHCQKAWQOTVELZGYHRNRPVXXVAPUAJHSUYBOJM GVQUGNZMGDGHBBEZILCWDMLHJKCRNUIDVBEODBRC ODHSDNQSHGBPHENWNVTKBPZVYIZLCLFIUAIZOTGV EPQHQELZAKNVDJLPTOJMJIYAYISSZFCIXIZMNGST HDUJRMYSLRNHZJNEPEAUGIZVCNMMRHJKFUUCIFQT BECNRNIFCMDHSJVJAOVKPOHRHGJRGEVUZLCKHZEJ UXIIWIODZVBQDNUGGCWDGSOUJDAWXCGETIZOUZQD EBSFSWAQOFRREJZKVGBGINGONSTIIEWQPMBZVKJJ OANLGSAEXVDNXSFZQQXUEPWSTLFLAJCSXQWGOYCL CFJFXOACZKDIUKOGKLIIPWGPXTLGKVTFOZDDMETZ JQNWFEFDXRVWKSRGCLRAPWMOZGQQMLVPDAVHCDAW IDZGWIFMVFFGVKXQMPATSCXNQDIUPPJYCLTRGABV VLGJEODYZSQVTSDLCUPXGTAHADCWDGZWIYENZOML LJKSUKUBQPWIGEOJGDHIIXRNZZURAJAXXVBPTJZR IHVGMNOOFOZWCRFFJVWJUNNOAZIOGDBKAWNOZWUY YLVGJHNRUCOILHKTDRVEEAFYCFZRBCGRUPVFSEFR VQEKQGADPQMFJFKMMAQQMNQIBUPHQEHBTSAEGHGR CRGVSEMBZOJWSVCBVWREPZNSRERVPWJFQDMWNMLM DBPNVUHPIFWGDVNXULBYNWEQBPPMIJARBIKEHZLW NHHZMTQOOUOCALAYTFQURUZBFYCJUAGUOUQSNRKO PDUZQHBZPHAVKZHEICTB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      STPBSSNCNJWCVEBVAPZWMDUWBKMEZNKIRURYEQFJ CMBJWAARIBFSJZWDTDASNLFKGHUGBOMGVKZZPVJQ RYRYIXCDWDOUTHAMFTLLQEIQRLZUVYCVHAJGTYQF RIZDWQKXQJYQVMVARJYDUTUVACKRMFAYZKOJCPDA CXYUWZPKJSNQZVHBWMLOFHUNKOBPNAILSOHQNWBT WNICFJKFQSWBBTEPHOPXVGKQEYTJVMIBYGMZBLIG PVTBSFPGQODENFOYMXNMBOTEJRXEKADPFVWSWDXM DSPVNPAIJFKOLHONHDTIXSDCVEPGHQHOCUEEFSGE SXGOPTGQZZHHOXAPRGYWHGJVXUHYMIPUPTVAXDUP TIOQPDVTUCHXUGPRUHEVHCKEWAFYQZUHFJFBXURF AMRDTOPXTBJEZFIHZRQNHHWMFKBRMLZCLXNDFYOT ZJGPBKBKPJOSKQTURZFQJXWLALJUYPYOWJUIBTDD VYUKZDJTIFICNNIREUOTJCHQEUDNMJUDJWQLIXYX GYZZFMSHDPLRLROLIIOHRXAXGSRZETZMIPNIQXMS AVTRSMLTKCAIPRNDBFPCRURWVWPCITUBQOKHDUQR NLWDTEJFZXCWEXPRUKWZIMWINIWCEFFUNWBWXFUH UZCIKKQDCBCWIOTWZPDJRHNFLLHQPHSEYBCXKOVW NCKCAMTRLNYRJZXEDQMBFLVWDIHYTFZFTSTFTEQY AMRUIKXUTWBYIDNSXPEBOCIZMUVNFKJLWPCPQMQB RKBJXIFOOSZLQQMXNTTDWUDCLIZUMTUSRKSJVRSN MGHUEYOINSUVKZMAVTBTZWATKPEAJXWPBQHAPYQM PMTELKOQEOCPOOUXQROFUCSFMECFNEESMHUHCJXS OEIQHQRVEDNEYHDSXCIUSORECNLWRIOEDULRZREU SKOODNNSSHVPLOVJWGLCHVPLOWHZHBMQTAKYBDRA IVFEVUYMEZRRCMQXIWXCGDBFKNQPJATZHIQIRXIT OZDSRHASUWJPCGJBJNQDOCQSRYCCARQDXGJZYECU MXEYHBKJTWWNRBOARWKBCVPJALJSBRZUROXLULHL KICPNDVCTVMVWPLMGNNHJUEQGHHCWWHLVPLTTCPG VERAUVANAHQFTZRUQIAPNWZRQMIRJFNLUSXDSHHE JCMETGXJUKPDSMONILHQJMEDLEIVOJQGDYQDSVGC AJABVCCHCJMSGLEGIOQJKUSILQFLDVGNIOHAKJYD BMWYOAARJLYUXKBQCYERWWKJPFXOKMTWWFLYNWJV BAGXLSDPAAOKUJLUXHFYHZVUFXLEBXKIXKSAYPNA UPBXCGFJMAEXYISDWIWABLEAPLVZJNTSVTHAWSBV GBCZWCZPKNSPTQBAZOFVZKGTGLEOCAWKWYCFDDSX YKTTGKANYJYYAHNCFNZSVBTZMRERPBTHWFRLTGVI ATCPIBVXMMMDTHRBOBWAJHBVENYBKQHZGLFCHZOR TZELJUAHDUNZRQAKMKHLVCAYWOCDPVQIIMSEZSZG TTWYZJONFIWZLOQHAPOANPLGROUEFXRPLQRJXZHM NXAVQEPAECPYHVOBHJOQSFATDAGJSWDMQUTJNNGD TOOBUFTAVVAPGKJTJUDNOMKYISLAJRZMTJNOXQPH OHVABUEOOWZFXWCHIRVVNFQEFWIYNRZSTPNSIYIH RBTZWTEQUWMHXMEGRHUQPPSNJKXOBJONAZZPABLS WPMHWPUMZNFWIETDXCHIBKETGHJTFYJORPSZIVLJ OXSTXECVBUIYHLPLCWECSXFCSKGJPSXRTBVRCDCN YAAACVEBYQSZIAANNEDNNXDKBQGERYJZVKOYLEFY FLYWUIMKMBBANXZUBGGJICFOYOYCBLLKALPTTPXY MGBWNERTJOLLUOKHHGBX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HZNVVFEWIZMOUUMZKMPVFSQQHPGFMXOEVBADMEWL VKFXWDSAWMYHECWFPMEMKJOQJQYKMPVYPUOTDNKX PAGJXGHNZWCILIENOTDNDQOPLGETARSIYAKYRMRN VIQTHZMROBGDAYFTEGDYYYOKYTMEPIPLFCMEUDMO IUIPMZTEORTIFVCSYJVDTABLVFFMWOABCWBLYAVR LWGZLHAQLJZXBFPNJVJFUKVOAEVXPZPKLOSKVFHU SFNRRTZAPYTGZXAWTTKDSILLSWMWIZWBIAODQHHD YHCNHRBXKTYEYWNEEUDPNRXUVQPQYBITEGKAWWTM PGLJSMBDJKATKHUXPBMNAGWBSMIPXBMWMFEKTVXK EAGTPGGOEXGJSENLCNQVUHTLEBPAMRUSISCVMFFA LACCIZQFBYATDJYVUMVNDMBHCRVDINPAJAWZHDBJ IDYUALZSZVDCFNWYAJISFPWMCSGLIEYRNPWASOXI TSDYSVZVDYFZHJRMNZSNOBWTZSPKVVDXZZASWUXD ONROTGEHHKMWXGCXOIXTNDGTWQSNEHIEOQCTVCHH ZLPEXMTRVJEPMOQSLBVDSXJIXRUXUOWYUDTBOFBR QXJXLBAUVBELGJWEJKOFBCZAOYSTWJCECCBTZFBG YPCUHEZDUSEFVGUSPIWNTFIZWPKRSAXHGFTABKUD WTVTECHTTJXJUWNWXMONKLLSPUQBOFQTAWNJDOZC PNRLDYFVDMEJPXHTYRKDJPARUOQRWZIFCPVZNCNB PJNAPHIWWVSRDFLTFWNLCYHNTYSATJGBYNCAJBVO FMLTBKYEYZYPXEJKCXHGOSAYUSDXKNOMDUIPSQBS BIFZHTXMPTASMQNZVQWRLUVCRUQUJHGTUYKOZTTF NVTDWFQACSHQGHTFDTTZFTTPVCCQKRQXABKJSEYA BXQTEPNJJUYKYZPKVVBJNGXYITKIDEDVXXWPWSFC OQBPTGYIQQOHSMNKHAMLSHOAQVJZXOTHYCIPRPCP YRVLKZISOWRYULEJTPUOARSGJALZKRBNYKGEYGZG EVFLXBSYXYWHRRNGYBISJWATCQVJEZSQKCJOYALY CNBVQWREQRJFCLKLNZXIMRYTKQHDIVYYKLJPDVDB SPGVFABJECUWBOFCXOBDJAABTUUVMSPJMBAFLKKC CBXOSGYSGLNKIBAPFACMQLROUDCHXJZRDKSQFMEI OSLWVDEAIISBSGESWPWRWSQLXOJQCLYOHHHUEZIC KUZIMNCLYIHZLEVKPTQGXIXBSCDLVIVGDVDUHDBX FCXUXQIKICZHPWIHGXCZUQRGTIUSWXNLJGRCPHZM UYXGSFSIPMPWTMQBAMAVJODJNAZMDQHIRXBKENYH GNRLWNBQAJOTRIBLPCLNENHPJGJWHHBQKIMGUBMM IETJLHFTHQWEURKZGSPVUDZSHPPIQZPFECSMJIUE SQBMQEZUEDXVLBQYLKFDQXFYUKOXFEKXXZLIYXEX ROVJOXIYZHDIPGWRCZRBQVMTTTFUJQVSCNDURDDZ UKSPQCFEGYPDFFBMXVWMRLVUKKUCYGZHYOJVOARL CMBVYOMYUBOPMERQMCWJSAPVOCFZWBKBMHVIOMYQ ISXQIMBWBXRKFICDSEZTYISNNRUWYXBWVVQZLLFF TRWXOWRHPGJKHBQDDZNYQLCXSQEAHHPABMQNUKCC EQJNPLQVNQZVJHMQXUVRDCJUZAPCBKDDCEKVACZR QYKCOBADXWQVDBRIBXSFKTMUDTZUMDNLBVXRUQLC ZVHSUZUFJPVYGELNHBGWDHOITBKMOHARZTFBJGXN HCNFXMZCOCGTINMORZIIEZZJDYCGDGSZFPTGGUAU EAAPWLRSWKZBCTVHGHIKICUCXQJHAEENCEPQNEEB CABXMILWVFZLSSXBTMSO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OOZEQDOMJCGTVYPVJTUQOVJDDYTLAYVUFIHUIBVQ LIBANUOSPCTAUCDDKXVBIWXMNQSLLUNWIGCUUHTH UYWNZZFBCBLHPTBPOZWIHWOJRPVLSCCOYGPSYEMC BUFYUNPYEKYIOJDWYBVEOLDVUQVVREQZGXBZCKYS HAHJMHYTVKRMMAXIRFRAFTSCXVKYOKSUFJEWVSWD WHGVRITMHAIABZLIUXJEBFCKLVHXDYXEYKOPXSXA GGSOLZONFRWGZRURDQKVRQTEVKHCUMJZCSWVKJWV JUHTYEFVHYGUHDUFYSWGKVNPMRVGXLVXLFAVTQZV LFDFWKSBOUEYPOWUKCIPZQZASGVVVSNTPYMOOWBI JKAZUETREQULNYRPDLDXJCMNYIFUFFRIGHQGBBUG YRGDEZCRPXXJLECDQZCUDPWOZQNZAMSNWQMHJYEU MEAKGIIFPUMRIDUXYUJZTZMLZVHXMSUCCQDHUOCC VTRSHPHYHHSGDVQJSSIIYNRWLPWTUSJCKUWPUZJD JPBKJPRIXQITESZFLGEOHVZPFWNZJPTZCMVOIPRW OUIGVXYMWYPKWAWHAXXNBNUWAJJYEEVMOQTCBSTZ MUPQBPFDIAWZZUQJCGOBGHKOMIDBWTWZNWINCMWZ OZBWARTTEWMGVZCYIYPYKAIUKTSJEOTQNDDCWRJM HMIKYZRRFEHDSCGELLYFKEUCYVTARNBHTQYXOUVY AQTYZASPNHQOGRUYBHYFMLQCIBMIGLFRNMARZFWW KWZFZZEJBPWMUSGEEAYXYTIYQJXHPTOYGTFFZCEZ GUOIAGSEVSXLJWSJRJMZYHXVGRQKGICTDGLNTWGQ EMYYHXEUYLJKAMIPVDWSUULQAPCVEJPHOJHWOICY GSOWHWHDCNZARWMUURDPLLNADMDJHSILDJJKOZER JKDULKTLMLIFFAUXKQFLINFLEMIKUPCRGQRJUOET QSSDGHJJGOUWQHWRFPVOJGLLYMTBILSAGGNVUMCR MXWDXVAVYDEDKVTUFXITYRIJHBGYVMOSTGLUSYTP SGYCWFYHFUFIQOMADGTSHIYMCVKCNITKKIFYZDLS WUQSREGXPNWVZLXMYDDGNTOQDOXIDLYCYKYIYRTM MAENLVWANIAQFYLBNIZMZPRGWZZXMOODGGWXICNO OYAMPODCTIKCLYYNJFLUTJSEGQNJRBBLATAOBIBG GIPLZJPCMKHJKXOPFSGAWAGYFPKCPJWZQPZCRPAJ XOJKTTWNORXUDFOYMTSDBKFVLKFWMXKYDKODFZZH HHNDPRVPDHVSCGCVVWWAJMGODBUTTDLQZQHLDHNF NTOELCGDNYKCLTZFXWWIVGSOBFRBVHLYJSDIQRFJ KCVVAIYGVYKPBSUIOXQKRFTKGEMTOCYEWIKDGBAD DVIYWSCRGSNQNZNZEKLWXWXOPFJRGBQIWVPVOBRQ DDMDJZZSCNLGKMVUGEDQCOZBIHYMKAQKPNVCBCTU ROOQZZCRYSDHUJWMLMZNDYGEQCYEIFAXKXQFIFTI MMOZATBJEDJNVMQQQQVQAECYOWVKYUBCLQUZLHVX XCIWNOIAGOCTBSJTEVLQTQBQSYWGPAXCPKIXHDSB BUJTZMIUQENCBHMFLPEDTMUPQXFDHREUDKRWLYST FXKEKZHRUCSLNFODHTJYSYCLYGXXDWPVTYMQBNSQ NFVKSVNUVRMPRUDKJQOFSTCDTIMXYPRJNYYLRUGK APQLTLYCRPZGYKHQXITWSQHJGGQXBTEYCWTOSPFL UAEHLFTACQSMWTSBOFNUYTOLYIQURMBHMWJKQWOQ JXULVHKCZQSFIEYRQZJEJZTDBIYWUKTJHCYZVMXR KHJNBFVPPXDJJJUNNYJXBRETFADFOKMXMHAKRPTN EWGYONWLMWZHUETYQZPI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      UORHIJKHPDSNTUVLZRIIKYRNUBTSQBEOQJHPNYWZ ACEJMTRIPZJZQBALEABWNNCXYWJXTWXQYGFATHYU FZHHBLRZCGXOBKBXRUKBOHNPOSWPRBRXUQJEYFGP UORHWSXJVGHXMODYAECNXXMILBXDBNKWGLKCVMXA FLLBJOXPAWXVAADUFAOBIDRSLYYHMIYNOUMQANWC XYTAESHOCDCBKPWFFYKNFPQLUSACOUJZJIGIHBVO YAWTLJTAQKVNKTNOEZHDVWKCFCUPZGVJWLPFVJUD DLNKHGTAKMLXQAFCDEPNWWBBFQYPZEEZUMZYOFCL WEFXDEHBFLHKXACYUWKJZXKBPYTSOYMQPYJVMFAD YOXZCBGGIMVTDQGZGRAUSJFYJKJIBDFAMLBLANSM NJXYXUYNCMJEYIVEJSYTTBZJLIQGCHVZQJSUFEWR MZBDTAPGYHXSJUMSZLMDXTOYWSGQJLFEIMVYSGOR MVKLXEJQOURUEJBCEGVKWNUUYHMPGUVJLTDLNNAJ QZWSXCJLMLVOYLEKYGYHEXXRLOPYWOJJXIPZMEHX BIYEGDYTSFLWGSZCKOQTUPNLYWTXYKDAOCACFAMJ AGJCNFHOSBNCTQSKISNAXEAOQMHRCLRCSEYCOOTG HJXAEHXQSNYBHFCMXXABNVWAROJKHNGYZXBEZKUV IGOLRLCRATIIXXAMCHDLXYGXKYSAYJVSMULOZITU VLOBBRJWHEWPEBSXRATULCREBXOORCEZWISJZOUV WZDIYSSFKDNABKMTFOZTREGCKXDJVLEWRRJPGTMC VPLQUGNLBSPXFQTBOVIJRFXVUEDDAAKIZNAUURGU VBAQTERGULJPHCIHPROLVHILJHPFHTVISNZBHBVB XPKKVPEZFXJODRMHVMTMIXSXFQPCJUNZGKPLKWKH UWQRTSDOEJPAEZOBRNROBUFONWCYLWAESBLYMBXR IOTAUHKOAISZEQIKHDPOTCXFNCRGMBVTRIRFNSLG DBNPENIMCYMTCUUKVLMDKGLBEFUUWGXARZDLDCKV EZBRPYPATGDDCXTCPBWWFNIDMAEMVBTSMMBMNKFE CIFXUGHCEVHAKRFABQYFFPABIRVXMNIXJFXHDHWF XSCHDFMITJEHGZVLIRDOTDDJMJKCQNRZZLKBPFEV CBAFNMJPUEFBMEPFOLHUKALNYLFFMSUHWNRXLUVY JUWFIDFPDEFGKRKZKPKVZLMHWHFGIFGZHOAUXNQL ZLUDEBOXUNVCQIJWRDHPLVZBXYMJSNTKBRBIDJTG SBRLWUWKRHETIGAUPZPNUTSFYCMYSJIOBMVLVFBT PQOLVKEBTTJUYLTUSXSYPSOOKFASCYXDNGZNBZCZ BRFDVKYYCYBTUWTYYOSJYBHNZMOYYWNCBVKBWTVT SDTDCSEHBPHHXJTNHFCFGCNOFTVSUMQFRWJZABIG DWQBBLCIAZATLSVOCFLGNZODVGDRMKWNEKJWOEYR VMLOGMFGEDALBYRTZCMIXLFUXMYNDEAWRKKHYGEU BDVKDGNDWRIRPCJNAJPPVIRLBVIOCOVZWKXAYKVW QFPOQPISFEUMJSHFQYJDBUSGMWEROXNXFNBUFQLF EMWSXMLQBYFNEVZUAFKNLWJJQIPXMSMNNZQQPUBH PFLTFCNUWKCELLJVNJLNUTVOXPWNSMCKYJPJMXYE CSEOLUXHZLQRVYLQUOQVBSPGDUSMSWRTDTCACNBK FRWHEHLZWFVTQTEGEPUDYMSUJEOAFEBGIIRAAQKO SEQAVGVLEXUQUYASALZWQFFXRGIXPOZNWGNMSIXE ELPGNOSJDAVVRLQSNMQNFZBKJOFKBRCBGVSLKLGJ GZZHGSQLNONSZSSZZFNFWEHSLNCSKIGMSTJXMYBQ BNVLBWMDLZWROUROFMQJ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SDSTIKXIXHMYJBPYPRGFABNYVGQLPNCDENXXYCRI VTZEKMPHOQIDBCDMXBZBROVELZATEORDUEPPTDTZ MKFKMVQOXNVUNDNNQBDBQVFMEAJPONDWSEIOFMAI KKOOSJMWJXUCZVRGSWMWETKROFBCSYMZHSTGNINB SNZEXTQNTKLUPKHJTEATAPQEKXFJBQVCXTRSVAPE JJJQZFHIGIIIGOAGGHZKJWTCPIHIPYYJDREATHBL DWDWVYERFWJSKVPAAJTJQHCPQBIIVSTQWTJYFWLT CVVKSXQTFZSCBGCHPNKCNZTMQLBYSJKAXBFIBWQA BNKNUIMQEZOOUHVCDBVWKSKDYJWFREOSGMPEZSRR VGAUOGOHNJMECAHWCRJQKTQLTPZKYKESRACCWNVV OCUFKHPUAICPGQHUEDBZHTYHPYSIAGSEFTLYVBXN IAZGBCARDMJIWPOYEPFANMGSDFNQJCWKRYNMISNJ KGDXCENSQOWMGOMRSVJFCJEKZONJWHZSUKZYEYXJ JJHWNECZXTZSDLPEOMQTCBTNKRTSYYJPEWNSCPIA ZMKGFFZNIUTPPCFKQOCSHMVZWSXXOLNNBMVYNOVX WJEZXYTFXMUINQFGFRRBSNJJKOXJOBTZJREZJCJH ILOXATXJRPRCBQTSKYZBLLMPDAWGNUBGWKFGKOPN MJLKTYWPYHIWYRRPYGVAQXKAPKDMLGXLNNFAFQJH GRCCNMUIUKOHFLPUIPKTGACKNDKHOGUNDKOBZYMZ ATXAOBAMXITHWAODTKJLMMPEZQWLQIMEXQVTNZWB KODLXECHGPZQHAZKKOCVPGLLUCTTSGRXYYBIGTZR YRWLTVGDDYJXZYIPQNHPKTBKSTKKWXSEVHAHGJDL QPDFOKRQLPBPEZWLVKSIOBUPYVCJAEBDIXPIISFS PWSETJBLRUQICNXJXNJCOVUVUCXYXLWGRUVAHKXD UTTIWBUMPDBTZBQYLDQSQNWJRLIOQGUWOKUWMJDT BMENUWTICDSXOHNZZWVFLEQGEAEEEJHJVTHEZDLZ PQMYPXUCCKUOGKEIDVCWDCHKCQAHZUBTPTVLCLHM DMJBFBZWTUUPDPZINXTEXTPZRTKQZNPETHKDBXZT JFSGBOIZWHGTWRZPTCPSJUHCNOIIELAZFKQIWXNA CDCZEFSBNNPELGKHYUYBUMUFVAWKTZNVFLITWJWM TJZVUBTZQPZHOSGTEHUUIPNKTTWZUTHSRDFPSGXJ XPMPTHLUYXIPIFLFHBIBJJZPOWGLNGLVCWLFPHON SKLQSNBIDKZKCGINQCDMOXOZZPXDPUCJBDKAYDXZ SHJSKKQHHVYEMDKDKHGSOOFKNMEHNGVIIWYTGRZH JGXEASAKXHYQDMALLKDXFFVRQYBRLRPOLGQOGKQU MQVPNZZGJFJIXWTNBYQTHRAHNTPSSVOITOJCAZUF GHXISZLMGQLNFPURKOVBYMROLUJGDPGYFBQJUBMJ UITOOAOOSNROTMHBBRTOWWZKNOIZZAQZHOKAINZY CCCYKYTMDFCMBGCAZXKJEYUFQUKUKUHMYXPBFNOH SMJTBDCNPJVLSROEDUKQQGRJBJCJKTZZAOJUPSUK EIJYCVYEXLITQGXIIHDMNSIVCPJJPVOIJFZZOVRH OSNIPMQEUIZDRZRZOXIXIRQCQBZVOHGHYJMAYUBH EAAAYHRINYZLTWNWGMNHAUZDHNZXOPSYHAHNODBT KJIYPWHBNYJJGEPALYAVBGUOJIMEKJMURDTZMQDW XGYWVKDYJKBUIKSNAWFTYDRYXYYGVADFEGFIZUVC SHPVQLRLNHAMFETMGARVYAZPACNXUITZMRXUDVYU HQLVFABUYBPMWZADPPKDRZWLCSGASSZRFZENESSO LTGLYJUWGCSKRMLHBDTM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SGUPVQHLYHVECAITKYRFLROIZUEZXEEHOFPXCVLI ANFBJFVYGODHHHIGJDNVUOIRJJVOMQLYCVFDNWEX PGGUPZPBKLDABTBXKVZBVATAOFBXZBSYMJHSIAHY HPXMHRDMEVBNFHOGBDMZRQPGWZIWQBELMIUKGBQS CTEDMRUAGSLYLNMKLVJFCOCHCYZJNIUEFCUXMWPK JQNWGGHFAAGJRLRNJBEGBEPHOABMXUNXKKANHOAR PPJHSAFALWPELJIPMANXNDAMOVEMBZHMVCSNBJGF ROLNABAGNNFISNNOLALVDUMEXCXOAGGSDLTSCHDY XMABHKKBNCBUWJLVQSCQETJZHUVOQKKWOLWKSZNU OKCVWPXIWXJOGWAVKIOACCGGVFKKGFNFFSXEIEGU ROVLXWYLXDBDZRIABFUWTYTTQULBRHGPGSJANHLE JNVUMRWEANHAPYSCJGRQTXRZVEOKOJOLKMQJHLGR EJESOYKQGHOEZHZMMJSPTFQVNOXZVLXICBXERUDP UEOTWBQJWCJEJNZEVGFSDGIFGZDCBSCNJCEPNDOT SDICJQXCJLNCIGSOCVDGEHJSSPURIYUWOWXSNOJV BSCSXAIWSXXERPYMCDTCMBRFZTIFSSDTYROGISQF JLGSACUABQAYCKIGFPKYHWUZAYFUSDZRBLTDABBN XUARYKFHWMRGHYFTMRKPDPHDIRIEGRXITEMACLET WLWYSYGPBELDTQHGGWXZZBUPQGEUQNWGFBPNKJDE LKLWWSXWNIURJYUPIHSHVYDWUDOUHHCEZFPVZQPK TJPPMZUSGFADLGXWGBJAEOBJOEOLIKHEKAYFFSBW TDTXVVZJADVNDGREAEMEENTNEVWVDNIKOXUBGCZH SJXPGWTRENFMCTKWWQCJCIDYYTJFNNYKDBYZBSWV LWPKSCVVJGLJLVEINEEQRMXCKLPTSHJOCITLOOKX EMVKSOOCNDFPSYRJAKXYVYEZMCSJXIALZJDWZVYK CUEZINNDDBFZLFQCEPJVCOJFRPRZHBDBMOLHJJIS XYJQEJQJXVAPRESSAINLIJPXKPGLQHYSOLDNVFJS TOPTKZYCTCLTLSXKVKVNDXMXMELEIPGLOVICLFFD LSOIMHKICILSTUUUDMMKVQRGXIAREGPBTEWKHULI FOVWLCUOQLMDQEOHTHXDTBIRTVXYXYSFHQNOZFHX UHODFUABQPLZPCREFXXJEBOCOUCVVEBFDGWJYQFU TBWLQCFUGTZCHHODFQPVTHGZHZOYPDGCQQMZHWZX NUFNRLUJUXAAPKCPQDCTUTUNOBAKIILPDVLLSQEQ NDQIEJLBJFEEGLIQSDNJNPFLBKJJBZXHAFZFDJGZ SINITCGJAWVBEIVSLQMQJPEGMMWVSXJKGSEQNOKX XVDAVGFRMSSWZFTMXBPULEZLWGKOLRFUZEUADZQK KVDGKHCTZYFTOTHJPNUYXQIVMOIOPKOCANGFEQCQ OOPSMZRETEIPQWDLITYWJBIODVMDQYOFCWNABEST YPQMVQXZXYGZEOMXJDKWCUDEECICRXNFTLTXASEA HNQRCWKKZKRWLPRLZUTUECEWUYHCXQGFHIHYLZTJ UOUNZQTYUCQCSROVEUXOUTSXBOLEQPWYXMUYUAZX UEVJHVLXWZDUEPULSRRZKWFSTDQPULBBCSUIEZYD EFPKRZAUZNGRMULGJMPBLSLRKXRKJWEJVJLVERZX JXRKIZENPQSBKRASSWLNAFYTYIFJZCXTUDMIULKO DYYXAYUMQDGAPORRGKZBAYBCTATILBOXDYFQHWWY JQJXZYSDLABSBUXKVWUZYBEOHSVUOGCGDRMAPPUW DDBDSCFNBPTNMEQYWENEELRUYBNQEHIEDNHGFHMI YMPQTUQUNVLYRMPASNPR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OSSVHZUPDWJYOIEXWXJMLUKUJYLZCJQFOSZNLODF OOGRTDSJKAUNDBIGTEDTIQLCLKWMMLDVCBXVMLTK VYCBVCPSNEBVIPFOUUREOEEMXHISCYOGXWSENYNR PKWDZSZXVTDDMDECEQUGMFOKDWCFKFPXKRNZYTRU GKLNHARPMIGTJSELMGXCFTRAJJAOPTXTWONTBIKV ZPKUXRGTKRSESNASYVRMZVKGMDTZIPHPRNCPEVWH XFWDKLDSEETKRZMHGHDAPAXOWAOWOZMRQCDJABZK KABZOKWFUUXKKRTXDJTQIWECEVNDVROUHPNTWFRI PQDXFVFJNARVWSXZRUFJMDOEKOIDGPGNZDPFWKRK VUQTCKQOIQDSLBAOSVPBWDKDETETJFRZASCLCOVB XRGFESXWXHUKRJWCNSWILXCYICFIVRSTFQZDYMPW YWIBLXDXXPOLIGCLGLSHXVPUYYECGIASYNNXELWL GDPFPNVDKQYMFAHWWVXUISKBBCURGMWCLQQQNEHB MBMKJQMPGCKDKQOSYGGQJEIHDSQAZFHPJLEUYHTP LWQWELOKPHCGUWHVYOGAXIVEGSJJGEIXNZYNPDTG EFWXZSDXQYPXMIVOCOXYQRYFRVLXRORHHAIDELYV IAOXWQNVRBCCGWBNVOVRHQXWCAHSDIVBYXPGNNSU GQCIKHKEXTOKSPSCTZMIPMAMORUBSIFVZTKGCBFU IQTDOLDVVLILFMPXDTXDTZYHBHIRCUKCLSVKIFEA SDLEDAKLSBETJJCARERVABGZMQTORUSKGEGXDRFT TEQYYDFNKRMKRJPYGSZKSAKKAUAFLXLMYENVCONX GLBLHDGPOBAHXMOOQYMNEJHYEUJNLFKPRBULTKVP JIEREXNOEHYZYMJENLBZMKBGQOOZJQWFENKXYYAN PJMYOXSAJROOHMXEKQGVGHNXQBQGDRBGXVOAUWPD PXRJAPBYEUNZNOWOSNEJIZGPYKBGNZWVCRHMXOED RKLBEXFUXWMGGZVBDGUUHSRYKFIZYIKSFZTAVXAV RXXFUAZDKPDDWSSDNAJOYHAEQPDHADZMAYXEVPAD DWGLFBOCQESXWPTUDGEMRQEAKCZTCOHZHCWDOEVJ HGFZIEJQSCIZLNAHGVIWGXOKNAMNVAIWBWOLMRSF KWZZNRLNRLEEHYWDEFXFRKZZHXIZRPYZQJRXMGNK OAOLLUVQGYDXFXXPQXGNJDDBSHDFHSJSBGYQYCSH JFEIGHXBERTNHLCZTYQPIIICYMNIUZYKXPANNDWA XMREUUYCPRNJOQNSWDDMVWRHBOEYDYASNPWYBYPX PYLILYBTCUWRPTMYXDGHUDURUHCEIPKCWDHXOOPH BNFJZAKEJMSGZUBICHJLUZKHXXLLXWCQNZNQFXXQ DOQOCLNWYPNTNWADNAQFEVBJXZQCCHQYQPPCIGPG QSMSKOICHCFBWULQBKCENCIKJWKZAHYWEDJUAJQH WJMHHCXQFKCXIPOLYGTSZFPOIPLCICKOGLIAGKLB CBBOYHBVNAEAXMDSMTCJYEWCHUQLRMEPQHLJXTRO ENVKUDFXKUCHAIWXHXEYWJICLBYLVBNNQTRONZYC OJIDCGURISVDDPQRDNZGXKLXRGSQTNGVWFSYVFFO BHWKQRAOVFMXLSPNNZKZXZFBEKZMKTVNQGAOWCGE YOWHFCKCUWWVOKAFFSHAZGROFQQASRXXPDLTAICL KVEEROIKYBUODNNQNMVPATGVQGPQBEKJHBZGZNIU WSFCNHQOGKICEXDPJWEXZOPHJWNYFDBLZHYCTWGS UYYAGGLOMIBUZAAEIFBUMEZPZYOCCSQKSSHTDBOI TBSSIDQTCORRHAUCUVZOPNKXQHCRSPCXAQFOMPLN YLGQABSIYQJFMTGLRUHR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PWNQAFFJNQICPUAXTETXJHOHDDITNJYDWIWKSQRC KGKYREACKQBVRLXNPXOSSXZVXIPSEBPXSEHPTUPU CBTCTWAKQRDBPBGOBIPOSMUWKGHHMWNKTMKPTECM CBTTCAWLEFEXCDXVRYWTTJUCPLLGCLEFNCYQZNTL NMGBTAVJNWTZFFYPWAUWSMYGLWXDHVUDMYBPTRIA NBEMRMNNHSQGGTAPVEWFUTJWDAJWCRXGUAXQMXTK TLTSCOZTZRNLBBQXGMKLQETEJUGMKLOLUFDKMLCE TLTBFJSTFKBDAHRWLAHWRLTNHSKRBIXPGHIXJMHR ORCXEXXTHNUXFWGGNAUJYZTYVUYWPFAXIFYGXLHC PMQOWUOECJSDDZMSWZPWAHFFLFJFYRJMHLJIULMR UEFMQEJCFENTOYJFYWSFZGRGSGBPMHXNXGEUOFNE DOARUCLVVCGEYSGPCROWRFLRQDRSLGVUVLRFIUNG SSNGCRBEOBZTNZUZBONIQKLROXZUJRLPUKSEIEBH PVNRBCDKWUVAITMOUHPDBNOXEDYWSKAIVYAAWYMI YVURDHVOUMLFRWIAWHLDVKIXBCJIVYLRBEURIFQU YDPAQBHOSAIBYVNIXHDWIDPCEAXMMENQCWAKBJWS PVZYZKPWRZGMLANTTSXWUOGWUMADCGYROUXSRZSR YMKAMUUHYGMUMUGGVXQQWMDOZMZFAXSAZPBTJVYT SKMNEJBFWXGVVLMAAHBDZVDHKMXMUWWMUDJXHPQA TKTERWFCJZDULMNYQZMPCAZMBRTNNEGDINHSSSQG EXILRWZWDXLGTLOWGNQZOITEOUOJHSEDPAWLMKRA XOGEUFCKPVLZELUHXPGYILGMTPVZSMXZKBEFLJIN TMUMADSSOYZLUPCRPZLTNNFFQPSVHQIXHONVFFPX UKWELSNNAHZJDYQITRNCDRTESMQIPOUOCBHSIQJU YCHSPPFUPCJUUMLOGPJRKCBNZDYHNTOPRRZYJMWB ZAXLRHZZGXPEXPVSYIPQZCRHHQIYTCKPHMLKXAHF ANQSRZGGGKMIIMFTGSDCGINUVQUMSCKBLTSLFVIN LSRFBVDADHXVGJLZICPEOWPOKQTFBRAPSYGKTTKN GYVCSNJWXKJITHSINMEBCFTJKFCXEGNGIHLMZZVN XQFSNLIMVYKXKJQTNEIYWJMUUHXZFDIRAEDDZRMT YYAADGPYZQFEEUSDZUWBNBUGBLOSYTJQFCNEJWIZ SWPPCOBJFSEQJBBLGRGNALHGMVDYEJLEZDBOJUSZ AWHFGKMEOMATGQJFGUDVHQIGPXQMZVQYONSFSPVL SWMXVQWGNFZQSLMYOWTRCSGXKJGLZEKTRYWIOYLJ YQFHPWJIPEOHPSMVZPFMTFPEHOYGQSVUMFYKNNDA BQNLFOYUQOJOVBQVZNDWIDRYHPGVXSQBGTOJIAMJ DHOJHATJSSOQJGNLISPSQKBJAQTTZYPVPOIOTEQG EVFBGSSAVNUCUZTBYCEGECSANJVQIBFSJQSCIDUL XSVTIWACSIBQAPBNHWMLQQTUVWFBLGZPVEXNIYTS LPEPALRZWGUBWXMHUNECWLQEJCMPCQUHHVQPTOEC LDGTIILDQCUZGFBBYMAUFETRFHNMWIIFJNMXYKCE UNVIYXCGTEKHTXXYBKZJLFYPQAXNZETZVDYVTQTY TDJFNVQUWRPSKEFQJINWLUOGESTKCGALPDEKZBCE KBLHECJDICLFZUDEBGCLNHMVLQFETHDGEKLMCBLF XTFBAQIWNBUGVFUHVPRUOLYATSSWABOSFZCQTYOX YJKDLEXGQGPUEQTAINBJWKQBXNWTMNSITFLBKDSC KPGEDUJXAOLEKOQFPSCGVSWSDAWRCHYRPTNQAWMB NPCZKELPSXIKWAXMDPEQ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QJIZDZMGRBBNXZBHEGLCVLFKGQVOUJAASDMNVUNK RLHOBGDNBPFLNIUNRPEZTDRNRJHKNTOSLBGAYZBH FUMVBIWQASXWCRZZIPZSUWOUVNMHBTJRQXBMBAJP FUCZVWQSFQOQCHAXFJEIABOKJOSQKOGGLSHCFYKR RLRAVTAQXFJXZWKATMHKKDNMUIPQGJASYKSRPHVD TQQHVNPOGWIPBWTXQEPHTFZZIESAMQFEPQWCXZWU GAHOZPELJAZISYFENKFNTHVOHFVMLSKJHTEIEBIY UYHGMPXFUSQMBVVLPVHPEUJFGQNPBISHQIVUPMMQ MKBGBWDLBUMHKGBEHTLHQQWREUNYPZLCBROZQSFY LGPLPTKAWPDORMCOMEDSEBVYBOXDIOYCNJYDQOIB ZUFALJRWKSJRCKHWPKZAJZYNXOYBLYRYNJIGWXPB ZCFATRJLTMWTRZHPQBNNIYWYULMGWBKMTFJQJPQG TJUVGCHRFNTPJAQNGCYQNGPXZFUBKNRXZKEWKYPC VLXGRNQXFJUWOKTMFVZYABUCIOVHLMWEAWTSWBKV JENUXUODFLBUKYXHEASOBABLOCHESKEFRYFAICZD CXZUGXPTSFXCORRUVVZUMVIACUZBVDBULAKMVNLD BOBZHWJVQGCEGUTRUJWOBPXPMMXYBHWQCUEUJPZI FMGNTGJSRWMVYBFSQXSIJLLIZVBSKIUYZLZXALUU QOHCTMJNRDLPZCTPDLSEUBXWQTXHLFIXHDMGDUFE EGIYWANUYIVVVYPYMARRLOZICBTRMYLTXCEIORQF JMZUWAYJGDOWNSNEQNJZAZUMSINMDTQSKIFDVRPI WMSFJQAEKWCGYECVRPIWTPWJAFKGUVFHVEODAKFJ SPPFFZBMNNNFQFOYQFEWIWXTCOMUXVXXXTAVRVJX TMNMQUWEATNDNEDOLIUVSPJPNDWVEZCVWVSFNOUH AOOQQNNTZVCSDUODHCJTVDLIIUXSJYJBTRYVFKKV YBBAKGIMANMWUVWEQEWJHYLHTVIPZWWLOKFSGZES UTMJQIWRSALLRIXKIJWHXWDWKXCSVPHZKMAYEGOW JBGLJROLRYELLOEWGBHTJYVMUDHUWFXPMLFRYLCJ MBWQFDUVFPFNMXRLBOALIYIOKDXRRWLXQRYZIPZW KOLMJHUULGIPLSHXVICRSKAMFVCBCCVEFGBVBSXW KZJLQUYCLYJLRCTIKYMIJPRWPNAZJQHOXRKMIMVN IRUVDNUCUFSVKKUKSSJEGKCJLFISXASVIBFTJQBS YLWSXKGEOWKOWDFYWAVBHOJYCVGWCJYBEBHQICAN ATAQEELUQBYAORQXSXCYZVVJBAIZNHIKRQSWVOXO SZOPMRCJYJUVKXFGQOZWQUYXMIQORGDUFPIXFFKD CPAPTUNUMURIMNXTATDXZORMJVNVUXIKUSGSOLER SIJWHSHRZZASJOFCLZGOXAZQZXUOYEONTXOUCLTQ NOSRRVAMHHKNHCFXUXKHNPMBNXYQAKIFYZOAAYHE UYDOLYAPOODMLMKCJOMFVVJJTHXSKLGAXLKINLWS YUFTGAEMUSSVCJDIBWRBXPWHBHVKHLLWKMIZTOTO QCTSHTOGFTZCVLCVNXBBMHNAOAPEIIDKIWHORLKC BKZMXSLYXOKLKQFUZFFCYKXIKKDVSEGAWVQAEWWX PYAVWMMFVGPJHLIDKBAFCGDQJYEVSVXKXPITZGAK ZSYUNGNDXZEFOPAYDUPAMSYBIRDXOILLYPYWORPF VEEEMTASOZDHQJCPDDHRSYUCQBDFDNBYHCPLSZHU CGOFXAWLVXUXSMLKIAZDEHVANGHTXAMKGZEUWAZK IZJNMFKGDYSIOETOTVLNTLFYUUWBMPAJEHPCCCIM BALGRLFTCHVZODGZPIAZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ZZKMWWTUSAECKJLTULSHDWPSCBGXZLSLMLNTQLNT DRAROVQLLMZZSJRREYPJRRFGMCODCFTILIMFJZNJ SJVJOAHPUWSGUEVKNAZGMUIVOMNFXNKZRHTTRQPO YOZHHOTIZFQHSYPSCRCEPVUZDJRKKTVCZYKJLUZW USSHZKVKVZDJOBYOWLJYCOCJSFDQDYSNCWXFRSMN VBJEHWLKYGPWXLMQAOZADFVMHPILBTBXGPWOUKEQ OBUGWTQUVNRLYSSQPCLNJWQXVGMRBJHEEUIQEFTX LRWWNFAQFFRIYNMKVLQUFUSERRZBCTTNOSYLXCCK AZWRAQVPFNNBFOIOVQULKFBCCQBGOMVRSMAATLGW QWIJYIQBMINMMEXKAZHTBEQQFZIFUJUUGWNCNIJP UHPCEZXLMVCDHSNSAHVSWTTJPYTOEJFJQYPBDNDT HROXGUBOMDDOPWNEEPQOBVVACFYXWIUTLXVORRMG WPANQPJPJCDZEYPNVKDPFZYFIHZXHDHUZXZSJHNC MZTOTZUFVOKKRUSIJEVJVNZNMUZLXHXNPZDAYWEX JFHBXZNVTLLYEVMKDTKBQPJAXQGNTUMUPDYPBHCC BNXODPCGYYIVNKPNMNHGIBABCOOJPXJNBCUGCNRL XDKNLEXLVXHJTRNKUYHWYDFDWTAZRLHIDZMHWFPT LMEIRFBJSBYEUHNUPVSWEVFZGMRJKNVCYOKUQZBU CGOYCCZVMTPDFIBEHIPALUURMLVLDDUYGAZVULVK ZBKUZNIKTVBCFMCIYSIYLASHJUQDRGWFOHOOEULP KKYMPCCPOVCCIBULQIIFYBUNEQZLMQCNXBXLDARL ANZJMXMQBQJSZDJDPHIYIVUOHTOBLGSNHDPTOFNK KSDUIUUXJVNPUSSFZWPZOYIBZBMKAKNUCRFJEXAT SGPHXHXEYORSSIUPOYYYYBHYTNXMBANVEVVIFCCF USKKRYDWUDGPPYAWKQZICQSFFRCPVQKMYNISZATB QGMMAGQSFBLNCTXZQBGQANZLPAUGZBSHZHSMMXMH ONJMLNZAWEXPUKJGUHVXTOMSTWAPKTPMGOIVCCXA DBIWOHEWNCKQJWEKLCUIJABYSUYICSCXKERDEQBP PESUGMTBJQAIINIFUZHQYGDLAMYNMTJIGDEPNGZT NSIOJKXAOAWUTKXBRBLMDBZUNNZRUYWIGWSWCNXE BNSKLUSBNSPRXKIUYIELCWAYDKUVBIXJALDGNRBB RRNOWVDJJEKHSGWHTNZJEFAROLBLGSDQTFYYEXMZ UBMXEFONUVMOYUYRHKXCJKSOOKTZSYHWJSXWDINX FKHEMYKPFOLCPERXTUIGYZPOORHUIEXTXCTPHEUA DFXNRLEMRCIOSBSFXGQYQYMFNUDGXWOZHCXQXRLO JUEXRZSQIMVTEKWBDYWTSCIDWRDHJJUVMTAGMKZW PPTQGVRVVIGYRWRVZSQTZNXAITPXGSEKRRWQBSJY FNYOJKNLOASOHKEKBVCFOSRRPVSYOSDMVSBRNZAU ZSNRQZAVVIIYVJCCMKUZGEDVNRDUTFHGPYLKOZBM OWGZEHSWAZVXBRVVRPJKFRGJMAQYQNWOCGCRZUXE WJOVJRNGBZJSHPHPJJXUCNFBLLKYLLCIPSWPJTVA GRAZDAICZGPPWHPYMCYDSAPGEWKZDBLVWFUWKJBV XUMQIDZKGHSBZTIOSAFWGJHKVHETXULCFTXSPLAK ECOMOBJVKOZFWPSJUIUFDMQVMOBEBDVUBRJJVKIS XAXBMHLNPJVMEKUZWGZNFOMDGCHPHJDLPACPOOPW YOGJVVPOTYBBDEFIQYEIVWMVGLJVFEGZLGOCFPKG QUCLAZHIMOCTKKORRCDTKAXXRYJYPUEALHVHECZM WROWIBPBKBMVDAMEDHII
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PFELMNHVLYKISJFOVCLOJBJIEMEHKPMSHQVUOUME YNJUTUAHWCGXFMNZDNEVMPHKKBZDARUHAWPROCWW BYQNSKHZEKVWVVBPHYXYUGJNXWMKEMRATBFEDDEM HIVXWRIECXMRBKAMRARSZOPXSCPZADBBSZRQXMHM RXNPXQAZBZQNTTGJXVWFXGNNXEUANUUFGHJOEFXW CBJIYPJZZYDFMMISDLRPUBWLQSELOYSQBZKNUELZ VWAGKNDVGYVNNLRDKQSQBAWGNHKQRGFFGIBVTKSC QWDOTBUASYENRZQISKRGADLKQFYXKGRMIYHQHGAO QREBMZCWLKESXCIYMNSLKLNHXIYHOEIAUPFRWVAM ZKFJISCNXFWKCMLKCBIFUGAZUKUPEURRRUFAYFIB CERSGBITVXIJJDMWETSIKNEJURUXEURJQLPRYQNK GVAMABVAKMTHZAIMAOICPPHGUPHHKKMAHSDKIBID GUNQCZVPWNVKSZSBYLHKDSLZZSLZMEEBZIDDQQKZ VFNBGNTXSTMEXEEEEFHHSSKBUICLGPERZMLQJAMA KAOMAUWEIPHKNLLPGVVPGJUADNWHLMBKSAYBFRZF UKRZTXCGMLANJHJIICMSLSCQWKMTWLDBGBCHFPGC JZHSXCNTBTKYXFBTRXOJCNGJCRKPIFZBZDDDJDSF MKXJDHOYCXYGEXFTXFHGWLWLOYEJGLGHYJCPBBND HXMMFFYRCNOZJLZOGUHBJFSKJKPKIUMTSVUJMBCF PFLWONDBZUOBBXVRVJQBYWCPIQMFQNKCPDPWPWRJ KSMAZXZWMBMXXZEQGAQQPRDGBRXMZGQCYBSEWDPI IMWNVCLDGWBVEVPKYFJSJPWJNWTMYVWHLSDBZPYP VQKRJROZCSTMASXFQWQDCZOBLSMPFCSJHKVRRMFO LAIKFXYHCTKKGDBACLQMMCVJPSWIJREEESLLQVAX PCEXHMVNZKPWMOINPFHUCSIRRPSUZBREGUSILOYJ URHNJGIRSMGBBYUNTARRNNLOBQXCRCUFMDXFCCYQ ZRKXSBOMWAZVANWYVAVCEYOBVTLSKUQLISOMREYO BQDQFQKSDJZBDTIBDOCBTDLIJXIVIGTJKUWCFTRV HUTOMGVRBATLNIUBTSENGKANFTWNCKTVGKZRISEI XMRUMRVXSFUNOJLKNLOZCDCAHONUMSUNAZIFCBWK HSFUALPSMNZNKRSORZEHFSHXLEALXMVAGCVSQXGY ONPCZAJEGOHNHSOJPRTVDHPWJDGIHTUPRYYNQKPP DQONEOMENOOBAAQKJOSOIDBHYQFDBVHNUVAPOBXY QBPHDMEFZTCRKQXVTXYXYONRERQMSFIQERELEQNO YICCNMEEPWRDITPHKAFWDWMFUOMSGQKSAVCBTRCZ NELDMFQGAURKNGBVCGXMIHLXPHRLRTWHKEOKHCXU TOGNWTATHINZDDQHXZHEBTJIDHUQFCFTWEBEXEUN YUHXSYOADTYKDEAPJSEZNBCMODALSYMGRKDQBDBL QPTYSOGBKXUNLBUUTGHKQCGDZXHTYHWVUQYDDESZ YFPFBJZCSYFIIHTVVJXRHTFMUKZOGDNTCXCUEIFG PQUPHEPHLGOXYYKIMYGSCKKFLBPUQXCSFRQFTEKL NJPCBKNVCDZQNDLGYPKXPJLVJOSZYAUTWWXEDWRS FKXBHGYYGIQEREKHFMGDIYGEZJZBZRIZMISULNEK QZTOSLYUZDZTKOGKWLBLTJYHEXMEFITEJTNXGXYC YYYNQXKRZIVJLTPVEUSTRKZDTSQJMJNMTORKWFSV QRPSIOHXZLJOXUQJQBHYMNTHZKUUWFUJWGIMHDFL ZIWYJSCBYFGWDPPXKWDVTAGYJMBVOGURIZZRJAUJ HTZEJUDZXYYGHPJEJOEX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RGBGZVPLIULTCFVPNOYTYVPOMMJLCCPRLFGWTGCI KFLMZMSOEQVWEVGUEGAMUVNRAIVWOWURJUEXAQQI ISBDPJUBKKEOUUMERZJBNHXUDGONIMBUFZZCOTJY QVOYNLKKAFGJVETYEKPDMDTXWTCXPKAGJZNOFUWI KGEACCDDJWQZFTNHMUOCDXLVTWZUVOCJTPSVFAHI WDCKHKFLHHKTMZILNABIMDQIPSPGPFTGBEQGSCNE INBTQQHRUOUHXGQNTOYZQRIOSFAVJTCOOTCZVNNW LGBOVXSSCAMVYSNDRYHCYHHMUWQIXHKGVYILBZUU IYMXGHQMCMOPWLFFEUUKXDYWSLIVMXWQAHGQGSQK YVSCNRCVWCHDQMKHMAODOYUSIHIULIKLANTHBTKC LUQXIBAWYNOBVSPKFGTBOZSXETONDMLWPMRRQWFD DMPWRQZFVWVYAZLSRWJUKSLGVSPHJJTYPXPQYMUQ AOSAQORTDWESSANRTAWTZRZHWVQDEZAGPYNQCDKI JAJQVNVKZKWGOSHELZOTLCHNKQLGCINZMHWFYKXA LBUVWUVXBZFFBUSOKTBIYLXXOLRBJNDZYZXHWFWO BTMKPWWWYYNWBYLLHMINREJNQPDMDZARKCDQCPQU AYYRDXGVPRUESMGQKGPKAOUJVIXWKYSXSYCFQKZO HODVWKCOVAGKGWLTGNUMSXATNMHIAXBUGIQUKEIH HIDHIVAMTYADBGPCIOFSIRPJSQZGZEAYWQVLUIRB LJPWBYZZRPOHWLSYNORDIKTKWDQZUJCLMFIXKXAL LZNOSDZTXRTJYNNSVSGZFXSXPPYEMLPMJQYNDWIX VCTMBZOFKCMQSDWKQLXKCFSGPGBSLFDRWZRGQNBQ IBLYUFIVULFNBXODAQHWLEYOAVVSIPDUXBQXEWKK CAEKWLTTYEXURNANXYESIYRPAWXSBPDOAPGZYGBY URJRRLKIPTZTGOYEQZHSQLENNVKMQUMFUXTFNAFP TBFJIGRXEHIHJWEZNKLJODOFSGVXPVPLTATUPKFZ IUFUZSWNGXQIXHCCBDGMPHVSWUGDLTTSANWXYYAV CVRJJFWABNZDJYHBIIZFMGQYVFXKKPRXGRXRMXLQ NMATWUUCQJWVVYTIPPNWNLLKRXXNCMJRVCMYCCPE PSKOKTCSDNJRIZFVJIKSZOPQTUJKUGIXBEMBBUIA SQWXFJFDJONJIJLMYASKIYBMEGVUIWBRCBOXQTCS CHSORZBRLDXDAQYJZZVOUBDIVOAILCIEWDDFZAVQ JZFSPQTRZRQYUTJCATLSVEQSDTJMAEDRFPJPANTD EVTLQNCUMVKVFPEOWCNDAYPFMMNHNGIFPZLOWWKM LHCKHNINGELZXRYOZNISIPFIEHRZQKGVNQQJSITN VZPJJCIDXMWKGIGRGWJLDLLXNHNMMWFWWIIOIIQW XUSUKJMKUFRAPFMPVEHBJOKGXIPAOQVRFKIWXGTM CDCILGCMUARYFAXHKQQSXJNFZGYSCEAICCYGPPYP YFHGZGEANLZPPZAWDQJKKCKMVWEBOBFEVFRLZZKZ GYSODDXTMEKWFYKAPZDBAYUUGCHPEDDMFKQGFWVZ XMKBCDMIGKEQVCZRXRGMPFZXVDOBYBKWLFDJPVDQ XABUANQMXMNUHWGOAHRBBFAGTHGQEZZSMLQOETKO BBJHETHTRHIJZNIRYUFOEEROPREAWQATKQFBXUSF FHOMNUFFGIURENRWCGEDADPHCXLJCQHSLXLOWSWL TTMTDFFWURYSUERLMDTMBDVTNZIUYPLUABUBOBYK VRFMORXRSICSDHTVYQLWSCEUCXETREPMBWXJZNTE WCNJKWFGJYOBHOCVTSFKASPNYMNTBVWJABYEKWSP BNTDWZMVTXAUFXFWIFFT
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      IDVONDXXWXKOGSYBPMBZWOLXRNTZVSHHYOKJSMXC BZLVDWVCEYWBIGCVRCFXXNEAURMAKYUMWCIUIADX NADYMKNEQQXAAWGMXBNIVJXMYZGBVQSZXMAWLVSH QDJIHEDBFXCBTMYBBNHPWRMBHFESWXFNIEBLJYBI UTPBGPLCRAXWVNUJWXYYSUSZNTIXXFSXHQKRTZNM TZNQUXMKJCKSZWUBAXPVSOKIDRGVPKYIINOHSHSR HUHUXSVJCMKPBGDKZZIFBITRKHVEJYTNJLPGTIIU WNAEKZVJEVKPGRVTUTKGEXJNBAAQOXMZOFZTDHBC JLHUSQEJLYSFIROAIPTFUNFYKNSPHWSZEMYDFBLR TNPIJJVEOINHKRKWHNUDJYURJOSXEGYCRUZMMWBD CYNRCABWGRMPPAUIOAWVOVHYBZEVCSNDWLGGNUDJ JAYVUMHNEAGSZSGZFBMLMPAEAJUMTMZITLBCLQSU BIDLQRCURJKESUIXMJESODDWVQXNQYRPCGVZCUUW ONWHBZBIPHVBMVFQPQJJUPVCHENIVUGYYSXVZOJH VIUNARXSWEUVOWNPCRHZGTRXDWWDZIZSUAKYLNSF LGIVPNQPYRPHFYUIACZFZZANVJTEACOILXTDZHHY JRLFIIVIWSYABTMILIKKFMFILQKJFPISFPOSRPED ENZMDBCIQMIWNSYTAHJHNGJJQICDCMTUOUTVPSNH NXGSPYKPXSVVOANPSTVPGFZKXRXNOSWGIZATWLTG IVECXLJKSVIOTMUROSXMRBUTNKUEDHDLQJXHHGRH QMGFRZJPBJUGRWXMUHYGWQODNWWQQCWLUIFDOEYU YBDRQOBXLJYLWEELHSNJJQWRAHGXOGDEZSGNNFVC NJBLNZVYJTTTKAPONDFZSDYRLQTGNKQQVEJMYBUC XHDKWKZTLOMEGWHFDBEUILTSDSNLRHJIFJYRWNSZ TUBYRQDABLCJYZHDIALHWTQIRRMNCLJRPDEGVCOV NCPJPCKHXOTYLVGHNKUMMSBFXJIFQJVBCXEDUMNF VYZCMTQAKMESYCAVCIPBFKCJONNVMLOSLSSTFAHO AMOPJCCKLVHXJQWTEBONUOXXVLGWSNBEOVSLXIZX QEJRAPTZISMFVTBEDQQGAKFNLLXWRSXNKTIKUTXE LDIMCKZNXMAKXIKVVOGMEIGMWIKDDDBFICXMBDGF MVVVFMICEDUULIIQSCXUBBRFPAFMJWZUKWWCTFMN LTYIWKOQFDCQGYKTUYBZOURLKRGFGKBOSFTWRIMH GEIUEEBKQWUJPKHAMESEBXZCXESKKNKWORLJTSXI TKHVAIGPWNXLOJJCKWPWCXHJRRNFCAGRZPHMRMKS FBLSXAWOQCVJATRNQCYSYPPFSCFAJFBWGWUXFTVT ZVXQHJBURUCGWBJMVJESHOQWAFJKELDKNKQJTUXS UXMNEPFIUNHXXZXNDASBZBSXHVBUFZGIBXEXYVAS MEDSMNLMFPMPJDHOEXISTGYSIFWCQQHWCTBUPMJW DHVWOZJYUUTUZZOXUHRVAXKFHTXZCYNSVXNCKSDB VKXOSEYTCKYMUNXLWIMWKAWEBHRJADVUYIPYWACU RTJJMQCZTQXGFTBVDNIMVQKBBFCPDUQUEAGGJWPI DQKTUUANELYLPWEEQELECOUFJCTAUXYPVGLNEWXV ERUKYUQPGMYMWJMVRSAIRBNWBBFVQYJOXZLQDENY JIIOPCUILNLBPUDKHYYJXAQKAHJIDAHGRAHFYVSA QBYYPFNTSZMGQSATHLQCEYIUVAMDVQNKLDTIYGTI LSLAEPMFTKBUBADVLKSKCESOKYDSIXWTLRWLFIHD VOPNZCIXCOVGRPOIMCRUNVIWGDXDVOCYRISMXTEC TBTXKHYFMWXSGHDGZRWG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GVTOWVJYEEVUOYNNVUQFYLWHFYCDOSWPXJSJDRJK HMCJZODPOSFJRVWYMCXIWRYGTXMZWLKYTJWHLGKI XZYGQUVTKARVRGDOWBGXYSFGXPOPBECMYHFNRQFY SRNEUWAWVZQBNTEXXTZIFLGVEIUTJQMZAREDWIKR LMXVDHBFVBVQMREEJEFRWZFJYZAIBRDEJPVGPYFV OMFKBRZWFAADHRNYCKETGDMQQGDDYMJEHRDCDTGN YJUYRUSALTNYGYZKNHZVFONVWBIVHOKZODRXGMVY PZEBRPBBHUNHGHCKHBIDOELXUJRCPHZVVYANUYHE KPVPVRAZNGZBQARHOTEHFRKMWQTGVFIVFMWEBMPD ZRWBEGEXRZPTRQJMFFFTKDYLFPMTIGRHGLZNWXAW FCLUOFSYXQIDVJHDKZGFZGUKYKDABGAUGQESFVNK LRJABNFEOQGRZXZCVVTTFZAKOHUGORYUSZLUXZLN UXQFDMASYQWWPVNFBASBTNIRUIRMXGRJJUOIYJPZ JVWIQVKHDYWNWYVGALDJSAKFIXEBGWIKRUGQDQHD CKBSAWDKJEMZFOYLVMGJINBCCMAVXIJHYTKBDAGH VRMNNZHUKBUTLKLUFEHUZBYRJBPEGVSRNPVNKOFD XYDGUBKEPJVERAUYOWNVTJIAMZZHNDHUOBLCCFAD RNVTOPNQBQWFYXWBNJBOESTJIECCYAELDALQGLBE GECQDBXSWTMHIDZJHAOAWZCCMVGTVFASWWPDRJNI HPFJHLKAMIOHENZVMRGWILAZFUFEZCEBWMZOEJHS SNRWJXCJOTDRFNTEXFJLXEXZBXNTRRZFYUSUFVDD UQXIKYIKOFZHMNHTCMNCXCKHXFFYXCDPKIWXDZCZ CJUXDUAVALGSNGDHSHPTUFMWZNGOZCNGJAKYNBVL FGEIYIVZLPMBEUIOTQRXCOECHHHETXCYRQUWONGA KZKNLEARPWEICZEAEELPFMFIZBLYCMWIHZCMUNCV YJFLIEVVLWDYSIIRFSPTJBDDOGEXILMRBZHKSRVD GKCTOYQWTWYNQLMASTVVPBEEUUOKOVCNFQDSOBRI ZATEOPTNIPKLEYGQARRHVXPLEBLAXVZCIAZNGCML SWWEWQDENCSOLEIVVBCZGTXCIFTHNQUZHRCXLXXB YLORVGJXLHDYMHTCFYJYWAFGIMTQJWCTEJFDJROE HZZVNPXTALSBIQMKWEBEWPODSYXXQGEBCKDUOMFE EOCBCYYYMXVFIICMSOBIMOHDIMPABGCXVXQGSTMK ZQMEZEYCNOQHIAQOOYEYMIKBWWLRTKPAMTFDHPUB LDCKSGPVORUOXKXPHJHUUOYRNXPQNWZDGMZOWLGY BRCZCPTKNQNHARRFSVIFZTMGFNEBQXDQLUGAXSGK ZMFHLUOPBRTXOVABVQAFSLPAAEKIVPEFUINURCKJ ZZDEBDXHVXVJUPUDEJIXBMTLCRDYCXYTYFOVMATI MSHZGWZSYMRVQANBNYYSRVHKQNECIBXOCJXWLECO EKZHCERBMZUKZGXPOOONHPAKUDMYSPHUPAURTKZF ZMTBZDPCUCCKCFAXEPBICQYJKESRICWBRYENLBXU ZXKEQCLEZZEHPHWEAQVGJEJZHWICWHVLHVWQWOTX LLHPEGFVAMWOUKKRSEOVHTJXDVGRDUVJZCNPCVFV QLPNLCWFSQTLEXSZODJZQNIGQRWMEYMLEKPFKMBH SHQGUMECRCIQUYATOJXBZDKZXMGWFMOWSPXXMUGX KFVZAFDIEKBKSYJUKVILAVDSZELYKHRAFWEUVOQI DMYDIFCYYYQWGFUSVIATALCMYMWIAAIWHOTOPKHR LVHZRHSPXDNVOIMGLBSKUNBBNXLWIFDEWVQDKFEH NADWXGFWNLSRHJYSTKOY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SEAMNHXJWQTXCUFIIXSFKRVRQXWVDIZKEDNXLXPL ELIAEVWWDQLGTYINLYWAIHPTULUNAGUXNIOWEVIX AGYOPOFKKZZSEAQRIZOODNEDGWMPYLKAIARSGLSQ OSFFSCDGOPKTBAXLURHMJSZPPHSEAWZGTSLZNXCC FASGXTWIVAKDCMFNDKANVQWFNPEYABZSUURPOQYC NTMEXFZAXXQHHTRLBMYAZSABBVLESXDOZIXDMEQJ THCVEITBZHDWZBZHHCSFQNISIOAAVHYFTUSMBYBY KDKCLGWWTTWYCPYRDDZHJCYWCENPTKAXUXVVUSFB FODPPYZIPTGZKHWVSMRRBKIKHSBIPYOVFUFGCAVW VDSPMVMZONASSFLPGIVREBENGONKZXYBHBRYBMLE MAAGWKNHAQSHFQHLOJCJMMXKLKKHTTSUKNWDCDAY DCTHMQANZXOVTMNEQGADPVRIPEVIATHCSCAVHMYM FCRYYIZAFUFRYJYTKGFHAYYONXHCEHYYPNXATWBN RSIFXGFQUSJKELGPLPKPTGBIZJWGKLMZYNMKXDTV SZKIDYKSZGURSQGCOHNZLDTQDCINSWAVXRZDTZFB KVNSLEUVRSRDYNIAKFUYXEHUWCFEBGRDEFNSIRDU MVSMEXZCSNHDLAARTCWFICQBCNVSDGKQZOZPAFPP FYUCFSLWVETYNIFDJGPTTUGGQTUBSFODLJQSZNHQ WQTAANECAUDMOVBBAZAXILRNCWKVIQYHTYDIQAXS MMGYXANFVJVSLQOIHZGKAFQQNQAWRZMQPYVEOYBL RYPHOHAEYIKAUFXOQTSMYGYISEYCTBXQZELJQNAB UCOVRZUZYPLQNGMXCRPOUQZHLWSPXQYUCTOXXDAE ZZHJPVQXGMMKYRDOYEBJSUHILWPRYFTLUJYRTDWT GOIHZWMEDIHCHNOJXUNDRSLWSASCHKBVDGWWUXUE OTUHIYAVPFTYIPCFISCETNAPKUOWMRXGVJJLNAHP WWXYJNHKVTVHJTXPXNGBFHEINAARZCOTEFKSUDJO BNWTRQSJYIOJXDOQPBZACXELRFAWPQYPMPFSLKHR PEPUNAXMKJZGFIPWEKHCZOPQZTRPGLKTEIYABFRY REVQRVZNQERPWDPNCYVOMNATCYRMQPGRWCXKZTZO PCKBDKKTTPFZAZGOLZGMGBMXWOVSZKBGBBMIAUKC KIVGOVZMEMMIQWKTCWOFCKSNYSYTLXZKBORMLHJF GCHUFAOOHANOUVOCJRESEQHFHZNAGGXTFJTMHZAW PYHSAFJPWUCOUOUXFSVETHRUGIVCXDJAZBKXBEFY PZXFHUWMMHYJSQLOQTZKXUOVATERLBFVZNRGYUEG XJVVUPTCABWRLALNZHDQTJSGJKIKQTEMDGRXTAEI WHXIFXPLSQEWKICVIIPMDNUPQJZKVHANZGELVRCM KPIYZXQAGVZHLOQZLOIVDHPAOJZRFQPWLYWPIHHL XAURCRLFGUZVUDZOTHEVZSPAYCBNJPQBYESEZYKQ TKTDKZALCOHQYDADOVTTLWNPDNVGRRPWGCDDKRVC YBNNWGNTLXPUWLLKLHYNSDRSEDWMIBSZVAIREGSF GYGKSVVYHSEBSTSCRUFFMVIBEXNTYECWYFXRXVEJ TNKMWYFODZBEDZGBTCLZMHKYEHHTHNLMFHFUCNEJ EXQQJGKMADSQRFBXLBEKKZBVTFULPKHILIHZYAUE LGAUAKYWLEPOVJETFNPSKOMILIXXGMSECMMBAWSK KHVDCBOBQOQCAVQNSBTEOVSNPQLNNMZQQFGIPPVL WHTOGEOUMBIBDEZHFYXRLBVAAAZCZLMYDGPUCVNC BWWFZSFLSNKYXHLWQJMUUZNBONVRDBWTUTXTWHLF LZYOTZJTPXGQPLYJQEXG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NNROBJCAQOEIDYBTTPTOMPPXPUMVOFJINZIMRCUU NGUQOURZAMANKJWGZSBHSJRREUODVXIIIQRYZVZB HUKNZKQHTNVSIOSJCLXBRJPLNALINHEHGVGIHTKL AGEKCMYAIOEFJKTPGQYUFFHOMGHQTVDLKFMHQDRJ CYGKBYITBQQZDLCUYEJIMBLQMJEJLTNHMKCQDQQK HQYLJSTQFFIHDTHIUMFGIFLGBWJGMIMSNKMMBQKG RONNOMHYIGVWJSWMVIEVJECEIHSJIKNDRRBZGIUI PZGHHNMULWWJQZXPGLTMNVNOWMLCWYRSTIHQNHHC SQJKETEDLVLBLUVYRCLRZULKWOPPWFOVRDFRKTDW WZCIIUDRDOICOJGKGIPKQXSEGFALWNBUGEDZCENC DYRVINIAHCFZQIEBYTTNAYSBFVOPDJDZQGEDETEE IZJKJKSBXHYOJBVADIGBICHQFGXQLHZRDJGHJUAC ANIWZQSGZUZHMEKSQNKMUGJEMDOVULZQAGICYKME WPQYSZDEGMMJISTCJXAZYSRQZFKTWBKHSIZMIYMC OPBIPRMIGOCJHVLGNCWHWENFGLBOENOFPYWYJSML XNRQXEITUCRWYLLFVXVZGOIUPIMWEYLTTRSFVRMA ZVAOOHZJOCMSDFTRBOPDPPIBLXYDTRRZRCBWABNR FQTXTAQGMRITACGKJQNYANETNSIOMRBHEJIPPMAQ RYJOEDLYUNQERNDXIQICZCEELVINLVQWZXLWDVWU QBHFGGGJMBLIXFTFFHKAWEWLRXWSQRJCYXWISXSJ RRENUVMXGDGBSRMYWTURFMNWRNHYEAVADVFUVGAO RHQNYGQCSCUXBTJWVLCLQXQXYQEEOAKZHZYVBWKL ZKHSTTCIIUBCXVXIGMVDLKLTXAYBEQFOGDOBYDTG FJZJFEEITJZHGPSOKDXLDNGYMXOQYXJJHSUCUZTJ CCVSDCOLTVUHVBBZOHNYWVKXNYXDIZSUBQVTMGDH GKODTDLVRFEOCGDXNYYCUNHRYYCQIZTLXPFCOOTH OAYPOFAJCUSDGAAWSHGYQIMIQIUGIQHENGXEILQH SNMGJSYHTTDHFDELPUXHTXASJSSFEZOWNPSGQNCQ VVAXAGNOPJUZYGTCNUSIQVOIULCRDRTILXQILMXZ QTCAFYZOQUGUCOUHXCWMSLRQJNDEDPNTNEMSYQAW ITHXODPQZZCPACMHARKPTVRMOFYZENHMAOTXLITZ HFMZQLRZCFJOIRMDJMCFQAEQXREXYPJBLRZDQDML KRWCCWCMMNGEHCNWYYFFKJXXNNOPMWLJDOVGSWDC CGHQMBHQZGECEFGZUSTEZEIYVBVFLLAHUDLGUZIF VSROWASGUHMNIXKJQGYBNLBZYHFFBVQRRNLLFSHR UVRLDKCEFLJSJPYBXQXTWESNPIWWZMXXVQGNOVIJ ZAMTGZOIFBWPFDFEIOHRNZXMSBQAUQIZESRRSLKE QKFHGEBHEUFLUXROGKUNIHVFQECNJTDHPLSTFJMM ATKFRLONQGQKQNPZOBDJGCRFLZBQEJHYRIZICXFN AWQCWAROTCPYPMCCRJOXEHAJRCPGSCMITIIPVVXM VQNPJXRCSGMTPTCBAJUEXPYASUPDTDORVPUHDJKZ URDCWGSJRJDNFHVODUQMVLCVNBHTVZOIXRUABUCW YXFOELKGURBNIKGRZVCFHUZJUMDONRFPYCOYCVUA QBKNQVWTOBTNQCSDYTEPINLHEKGIXGXCFMTCDUMJ ISWXPSZIOMAVGYNUCVEVRYHKEBTBOEEDQZGLKYLQ LHMHDUFCLHIQFOEVGDMPRMZJVYWLGHINPTLRPYWM CNPYODEBACGXQLYGSUQXNEMBJWAHZDCYIHSKGXBR CTOBQTPSHSSBVZFSBUWD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HGJMMQOKTLMBGRNCZTUWTEKSYJMCUDOKIPXJPLWN GTKPHWDSKCKKGUTSTIVQTQNYZPJPCIHQXMETBZTJ UPLCAZEGNZLZRRJTRCEALRIQERNHOSKJLFLYPTAH ZDCCJBLGVOWWVGBVBEYJRVLCPCLFHHISSRDCUGPU QFWQWAPYXIDLSQGDPUGBHHLPSCRFNYRMEGYGKLCC ZJUSZXHVYGHNJHHPDKMAYRKMTSKFTVURHVYBOORD EEBUYGFVCGJLFAJUMWQQITBQLBCJVYFDKMHDNQWX QIVJGKFMFEDFFINIMPRKIGXQSUEWBVLKNAAZSWMD EMOQOTSRQSGUDTTTSKUQCGYOBBFEXZXOTEYTTFNK KOQVUIDGBFSXMISRUJQJTKTXFJVCDFTBENUTEYVY DFQANKHEMCDLUUZNHBPUVLLJOEBSHWHTQLKUBHIE QIQUBZJEUOZJVURLHZANDHCGJIYCXLDLYHSEWMIH NDQTWZWORPWYCMGNWXDPECQKDYPLTJBVQGCWFRYN EBRGSCXDMHSLZSCWPEHKUUPWVUTEQJLLHTNMFORW LTIILQVFQFAUWSARCYTPFSTTNLQYMWVTGWQGTVDZ PJLISSOPXMJKVXLUKKBEALRCGRADYIJTULFJLZGN JUCNLLEICRAFHAINEGJXBOEVZEEOELENZBDCVDME ESRSPMEPXWWHUSOLBLFDSOUHEREXPJHAYABTBENU DZVUWDZAICNLAXOORGLJRUMRORZOKUYAAJEPSIJJ FDXBACMWZQKPJHZVLIVJCYNIVCINZWKHFLQONUZQ PFZEMQOIYFUJTXTZHSWEAQFXMDCYQVEBTXNHTOUL TMPXDMSBURNQIRLDDQOPPMTBPHDCHVUQSFJWCVGU VZLQGRIEUSSTCHLGTMMNPAYBCZKFYPACBYEVMXWW KWVELRFOJSFXXNBJJWPCLJSZQCIRZASORJPCYMXK CDHOZKPAUEJRVUAMSFAJXCNJUVBMDQYBQLNOCEQJ JHYTMSHLTSPCXVYGYSQSXBRIBSXSDSHQNFRDKOQF GVILPMVUGAQKXFOHSYFOZUGXRSBZRERGZQCWTUSX FYMWOMXVGRSGDTOGSLVFGQTMOSDEBPFNYIVLWMHA EAYCZUCUFPDMFEBJRGDCMHEBPDKAWRXCHKPQZATL HHOQIFYEVQIHXUBPTPHGPYFPHCLWXCXUTCMIMVQN OTZRNTFDDQTJUAWSGAUCDTBHWMFKUJESHBPOZWRN DJOFOUHXIGCOGOGMEAVLBBYVJRWLHUDFMHAFOLKF SMFYLGMSMATXCHCHFHRCMASORPNFEGKWUBPKPRIK XCAKILAYKQDIHETCABWKZGZVVLTWDQJCWQEGJGUT NAEJIUQVOKSCKMEPCEOJZXGBJLANVKJBKLEXVYFE PVGYJMRHPOIIHMLDZFDSHCMRLOZYCZCIKSHBSCPD TWNRAXPXJZOZONRFYTVVYNZGZBXCSQSTQFXPDJYB JVRRJNKQMOOYHLLHKFAXBGHAHEYPPBILEMWABFHF HSGSFPPDWTFNMUYUDLTPLBSWWGCOPZWJYRXUNBHP GJXTQVVQRGIMVNQOGUZJJARFRISTSSIERKRJXRYW DNOQUUSVKXABVWURZDRLYKUDIGHCLDLMWQRKZGSS IGENZRRUUQACWJPRAVEYWEOVLTVEGPBOYHOSAASW AUOYADRHUUTTRESJPXCRCCRABYNPBSTQJMXKYYGX LPMUSAQTJEGNTUNIHETIEKIPXBLAUHHRUCIPVDGX PMFCEBWEFVRCUVZDWVROUBPWXVDNKQGTTSKGJSKG DAGICHOIUWAXCSQSOGLVFQUMCDSTVACSVTCCXOMK HUHPRVBVBDIBYCTUHEIGZECMJHIOLTUGOXBVXFCQ TFDGJEHETENDUOQQHPHL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JMELZLMXCAERZACDNHCBNMGQFJAMAZQGVUVQIVNX VXKHSPZMXPAIEQVJJEXXWRXHFDTHDPMCRBCOZESJ ACRQOCBLMQSVBSZLBVFRVOOFEODTYWRRDGVCLXWR WXGKARYXNITVQSZLAEXNGWHYCHLFLUYBXMCILQRG LNQXTTNOHRBVRUTXRLINPIJKPCSSKGAJRAVOFASL AJHEXQMWYCCNHFORSFKFQTSTCCLNUEAKTMHVWMJK AAMLTXPRPHPOGQSWGAYOHRJVDPLFVAWFQWYAPNEG NSFSSHRUOHPSMEONCDJSHLMYYNSAKBESBLAHMEYC MRBZWFMBOUNHOFNNXQWKNTQMGLWXBKEGCUEONDVE TSIQZEXDPEGSIPEWQMEPWJPCQNUSVIJAYEMINOYP AXAFPCENPXJGFITLFQMMPJZTXPHFQKLXFSZDBJGG KHPJLKWFZXUBDPCZETXSFDWASUEDBETLULVVQSDS ERGXTIRIXMTXISDLWPHEZHYEULXAOVGHHMAGYVHB LDCWTOVPXRFQTIZKVYJHVXCGEDFBVPFXNQZAWNDK JXDWFGQYRUQDDRXKPLLEDAIXZOBXOMMVSMWSIWNT NQCAQBYDKITKTHVEJYVKMMPIMMNHGEWMBFJBHRQK FHTYSWKZHQWVYSYYKOXMQPBDETVXSVXHADPZCINN REQCZMKEHBZQGRFOSRQLAUJIYXALITDBDBZEDHMR KJVAQQYHXEQVPBEKKMPTKOMXHEQTLNZFLPSFUBOR HEOFGFAOTBNPPSTUCJLYCWKGOWLXWEKCMLAZQDBF XWUWEIKESMEKBDEXZLACZBEFLUMVMFZIZGCEHZEU IUINPSCFRQTXGIUQRNHGYNMVRKLYEPPFVFWKOULX GCLVSOLDMTIGZOEVCIBAKQBEBMEYZGMNQDDQATHH LMHNUVTBAAKNNJUAATNCYQAAQJRUTTQRMCDNCZXI XHARAQIYUDQSEGEATRXECSOTFZZDYWREAPWKPBMC XXKXRNMFIXRKWMYFHWBKRYWSGMKNPVBMIKCBHCFC WRNBLHQSMPQZUNGGATFXCNUHIYDGJZTHNNQMWPKQ DIXYPKSTPZVDUCYHSFBRMDHFTSAIAWKQADDYLUSP UQICNJAEYIFTJZNONUIOMBXEQQPSULDNDVHCVLUK SKKUTIZZBJZEVPHXEYAFFMCQHSRLMAFRMTGEMEME CPRTXHFATBMAPHNXTIVPLXOMEWCIOFNWVKSOXKWC XHQAVGIDMCNIOKQHQRZDPZWZUGOVKGKZRGZJXHRX XTFYTGAHPYGWAATXNJBSPBBFCNAALXCVTLSAUVLQ LRGIJLKWUCBMFSILQHEEQNSLVPIDYLFSLZPKCNUA RCBJUIFNYNBLYMZRYTAGCVMMXNWGWGOCQWGWJYZG RDCZDPVVUIJHUPUSOCIVQUOWROGYFPQIMIXJGOJT CWLNXTBQOXUFMFYJHYEHWCLNVVRPRJQNAAUCDBKW VBWFPTHAEORPKWVZQBQANVUDBUVTCKQETPATHPFC TWHJGMVCCFYXPMVYVYTJKBNOXVQDBMSMNPRVWQOZ RXZLECDDSNOBKHCLMPETCCMEFMPBLHENKQNNPQZZ ZZKDACPXTAMNUQZNCFCMDXVMXADMZFPZJPKZSJNU HLUDMYEVXMIUPUJGOMPEOJWXLQMFQLJTBVDQKLVN NIWILAEZVOUJKBGAATYVTWVSFDUDPJZCXEOMUBKQ CNVBADMPXHTHAGSLVNLSXFWXYRDMSAPTQFPZXTDS RNPGJSMNRQHGGPBUSRNOAJLFRRFUXAOYTICWGSML TWYEQJPVNETSJMAJHYNQZQDJUCWEKGBYIBYPIXYC UULCFDKMTNKCROGLTTQPVWMSCJZFQVHZWKISUTRI EPPCGUDQZPPNHTDVXBZF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YOVQAEDUAARJUIAUNTYTCJOUJNAGCPLVDUOCFMDT AUPQXOCEJLBCMDIQHQVVTKRHLMQCUPOTWUGJQAOG RSIVJKUKJWGHXDUHYFTJLVQAQWJCWORHZMYFPDWV HYAKNDAUYCTTCBYNWNULUICNFDWDPHKBBMLVMDEL RFRMNJKZELSXPPEUNZAXRJGMBOOCYYJWSGVHEIAD AWFWUDFDAFJPEHUPWMMYVEUQGNJFKWXJASZZOIVV JQBJHFIYJGMOMVTUKEHNBTEMGDHVCTWMGVUAZCTR BAVMZBVOXUJIPMFURPDTNMXDEIXRCKYERLQSJRMI ARYITUQMNVZKZRMYZRQHFAGMXLVLOQXHQXHFMMLI PRMDAUXEUNGTJFBEPUUYTGYDZLJWNOVDYBSJEVUW USXFGJZUPJWGMIATSYOZZXGLPQJBHXKPCCYOYIXO JNMKSMATIKCBGIZVPWPJPGRXBHIEVTKJYJHYLRSG BEYWPWCUNHXFMPWOBADNZVQYBLLSGLAEPCPVZPHO ESUQQJMJLDQIPVDCQXBCUGLQMZSCTSQOMYKSNBZW PJKVBMYUGKLZGPFIJZLUGAWMHMIKMWUJYQKRYGYD FOZZMGPYDQLGFDAHLUQGHXNAZZOEIFNHVAZOYTWL NQOUETQITGLSFJDRSBGXUDAAKGVGSIWGWQEYRNGF WQQAIGNUCKSQQSOSZJBXNBBOSWHIYBXMQPJMYDNY GNRJCYMEQQLBVOZMTUEKJPYIIIAABQBQSACPHLRT EYVZJPICMEFRPYGZEYLSYQDXGLIXAQWWCKOHFYPB FKZTLDSSBXLHCFEYEHSZKSFBNLCCRGXAGLSUQQDX GTRVXFBCKGPRWLARIFSTCLYMPYIITYIMENRXKNOF RSQSGMEEXGIRQFXTURRPJNIDSABWULWKGBNOGHIE RZMOOOYELTFFDERJWHMYPYXURHFNKLGUBAFISSQC TBVTEQOIIPEQQCKOFPFKRSADEWUCGQEXGSHXPPUX PVWKFAYTXDTASEQUEBXZFFGFLKMMIDZWYQIEFMTE JUTXFGTECLVJCCHKGASCAACYYWACFIBGEJRLCFLY VDVTLQYHTADPRRPYOCDGZNBMPZTRYNLGGRYZTJDX NXAQNKWWUGZUELJRONSUXWAWBATRAQWDSTEUHGWE VCHAVMRCSXDRUEAJNTYTDBUDPAVXNPYKSESPHJEW GNNXKFFAZFWNINGBYOCXHSYQHREVCJWOPPSLOCOI WWPQFJVMMBQSDCWUUJQJSFQCBEXIZMNGOIWNMTLK GTJXUWZKMUFZIUKTPDXPKXZQQROZDYUQYKZDABQV DQVOCIXJVPAFCBLLNAFTSWNTDHHHCKSJLRBOJNXN WSORGPLFONVUWJNUKFBQAHIFMSGIEVMNYXAAKZWM RGRUHHCJXEDWOMHQEJPKHCPMOZWARHFGAMQYLPEG DHUEXRPUZDYOGWKLGWBJFIABHOLRCOGLBQQACEIF YQTPLQTOAIVZURILDCFCOOLQWLFSRWLGKJZMVQBN QKLUTONUAJIZLCZOZERFFPBZOJLTFMHNRPCWCKLD BKBHMLCHREBRRHUQISMMBNIBZTBNKEDWWBLNYPCI KLPCIRNECUULBHEHNCSSKBLRPLCVUVEUIKYMSDSD QKKOVIRXPRFEMHXXLUGZLPEYDUPLIBKFTGRCWYIA SEBXYXDCPCZNTUEYYRRBVCZSJSUNCIESBDJZNPQF GXVAGZOUJCCLNTMTAONYTVEYVCYENAMPJZDCYQOF YNPQYJFUONAJGLLRGQRMMOOLIIRJHYVPIKHIARIF HKSXHPWVISYOPNZCHJOGSYNDCOYKGIMJFOECBFUJ VHUOTNEGJZNHLQBNNHMOESZQEPRPFEGPDQOVYHUW SRRZYKUKPETEVVGYRODT
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SPAOPBVGVDOCVOEPDJCEASZVCULGDXRWJPIDULJW DLMQITBPQYLIVCAQKTFAJPVFHOKFONHEOBGADYQX ZERPHYKWBGOGNQNHOAHYJNBLEXHIZONJHGUXNTPF CIXCUTRBLVZNDWJCWYJUJMYZRLEABBJRUNWNHKCR MNNLFPKGMCCEHCHQBQOIYMPPKLMWSRIPYPFYCQLY HRPMKTAIFOAQLMOYUTMSSKKDBXCLKAVIAOMFACBL HVPAPADCAAKTHQVZDSKOTKTBOKCTTCKHSITYPASN TOOQKEHDTCCLJEZJMPVLKHICBIYQPTAWIUPNWDVL FHHKPSIMFOAKLLDVTUEIGUHBBWGOEXGJVWRTEPTM FVZJEPUFLXCHITKVIFMTFGKQLMYWTJOXFXDJSKOH CIMIVCJZGGTAVRJOIWLLXSDWGQRKXTNHBJZQZXFZ YVWIMJWYEWRDQZGPSFFFGIHDUTIMPFCYURWQURNI ONGTPXVWKEOYKCEURWNELMICHDZBERXJQQEILQBC PDHNTRUUMVXEOYIFVGKPOLUOTLJLJYNRIMVMTJWD VMOQPZKEQURMWTHGJVTVPAWIITKZMUZLGAWKFAUB TPWWFLCQFWJYBJFVEYXLPQCICDROBZRVEFUVQKLI MQMZSMIGMPFKZRJNRAXXLZZQTICMWUMBBCNDRAJZ GPBNOKNYLPETQITRICRRIMKLEYHGUFODQORSSUPF WYPYKKOONVTIBIOHJLITKBHWADOOJWRCAVLWOIMY EZBOIPXKMAPWJRWNEWZZSNSSHGLKFSXDNXMJJXBD BIXKJSRFTMPNOLEGZZPKPGAEXGGTUANCDGMXLGTR MEZALDEMLRRELPVQAXOXACHTLQEBHBHZWZNIHXZC CLZOHSKXINOPJVFLWFPCBAYKYKSRGYISZVUWZCWX GUPLBJOWXRMTEADQLOOJOEIDZJFEMQLYUKUODKPJ JCIAIKMENNGVEMOVMQRFGEKNVZMMZYAQNABKHTXD HXLWFHNHKBREJANOUPTSMHASRGVCGVJIMXYXMZBZ BKTESHKOGQYODLJTSFVOIUZRCOJSRKCKIKGBNDGZ KXMJOKNRCOSJCEHLFAGMJTEWXPUUZCMXQVVBKCPJ VNFCSYLWYISEIGZNJWPYHLWJEYHMWTHKZHUJHMYZ FZNWHKYPBDTFSVSNQROYVASHKCLJNHCZBLBXKJEH FMWBTAMRBDSRLPDLLMCPTMGDJPTJZRJJRWJCDUVS LHXINNKQEMKEJLTYXBICAGESFUESKFAMEJXJBHUD VKIOVHHGKJQGTZIWJXSETRAOWQNIIVGISACWHRWP UQQPIJXQSEUGQBSCTQSSVGVWZLLWFMJYAEMAJRNX OXYZKTIMYJVYIXWVJZNDWHFVNSCNPSOZTIMZBVOR FXENNZWFCKLFDGAOSKFKBTMZEXZMJZNJMUHNGKOQ RWFEVLIGHRFMPUCZCWELQTNGBEQFAFCFPIIIPZWS VCNIGLVUGFLTLOIPXDSJAXOEDBDOSSELUAHKPFZZ ODTZBEVXYKEAGRDKITCLCTFWDYFFVKGXXWOFKDVJ ZSJRGPUMSCZJVDZPIFFUQFTXIFSKQKBVINAXBOKQ EANLNJKRKIWJAOWITCREUNVSOPTDENWTRWEIEVIK RWDKFEYUWVLBBQGRZVDGFUVVKZTCSAEXWXDDDRWC LTRDBXBMUJTCNHUPKURFCLTEHPQMZWWUUQENZPKM EMLEVQACZTGCSMIOYHQKTQUIAOZFMVZQEVGFVHEA VRYWTSLHTOPRGDKTINXTIHJTLUVGDPIOBDFBPDJW ZETBXYWTSDMAPCTWTIRYKJEURRKGPVFMOZKHVXMS JKCFMZRHLWNGBVTINWEKISJYAQRBKPQYNHKQBSIM LPPQUAQQJVHNXBGHFJAK
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KVSFZYKQEPMBEYHBMJDGKJPMZHWUGBDFHAZFUIUT WTZIJPXTBPCUKUIMXCCUWXFXBCKCRAMMLDABURCV RUTKDBJICEUMHENZJEHSDKEQFUQQBSZGZGPJXRFM CREGXADQQLPWPFNFCBKFWRFYJBIVBGUHYAPPJUEG BKYJVQHBSNIPBKHUMHMKTNKEGRMYKFVLXDITIXOF YJIKZIICRLRLYNSXBNYQCSEQFXNCXJVOCQSWKXIL KUTQLOKAUNKHMRATNYGKWPIGRHCIJBAPZZVPBUCT PRMBGHAAGXLEZMKLEJKUWCJXQWYIVTNRKMJAYMRZ PPBFNPYVWGQDSHIIQNJWDVJAHPTIWVVTKQZPRCAQ QDGIRXLNAADCWWZGXADSLCKGVLDSLPGRMYSVRIMF VUBAZVJTWRHQQKPZGUCLOVZKCYQOMADVWGREOQHJ TDMBJYWHYBIEHTFIUDAWMWEOSRGZVAEFJTNKHWUT OBWQFIVRYYNBIUSJACIQMGWCFWYGDZSIQFTUWRKG LPWGANLMODKHNQVJIVOHACIZSHETMAQRDWRWOGQQ AVYRLUPFRMXVPITCYUWFRKHPQBIUVHXKPAXVRWHS EWAECZCPKNSLVLTHLCCRFCZWAOGZWBIXGTWHYWEH JSXXIIGRRSDTEQXZGMRJGTEZEVHKONJZDUCZTZPB IKIKEPRWCJCZDSZZLLXDEKLJAWBBMYMIJLUZIYRQ LIANIYZOHPCDFQTFIMPJLJZTOKPZONDMDPBGIWFO XPMZRWWZDVMKYMDTZKOKKYHAGTNUYVOUHPFQDRYB AYDXSRIGFLSAWMTRHVKAXZWIHCDPCEYIYMWHJBLU TNZJPGTXDAOWNSNGXYYLOKXGYJOBAJRFHDJRFZLP KIICEPZVMSHEMRWNYSAXORXYXBSZFOHACFONICCT VIOGWRLQPHMKEFIXQFHNQKTXQTJUNCFAEXVYNBQP IXZNDZPIGYHPKMGKKIKWBECRXZHHDCEZNXMGFWHL TSIVOXLVBCLUXCRGQPYXOHRDWTZTDGBIAOFFLXBK MISNADNJAYHCVQBAFSPBAKYOTNKIYWOOSQSTAZRK MZKDUISYODGFCROPDLYAVCTOLQGIIEGAAHYFBXSN NTNYYTJLBPZBJLUJFBYTBTWVKLNPPRQHSAOBNUJP GLLPFUPJGTMWXNRHXETATJHWVEAQPBIZOXPGHAAA DEUDDZXYCCFTUXIQTQFWVXRZVLLNHNILCHAVEEIC IGSXBJCPOULVKTAUILCSNCSSXELUXRBSFAKDAOAH PBTSWYRZBVEZFUJQXZYKIRTPOQBTEECDWNKAEYOE CIBEHYXHMNQHPGHWQDOUIBBTBRBOSFJJRTKJMGCB IEEHLNDDIAASWTILVNNNMNTENMFBBWFTWHXACLPU KNADKSFFAXHEKVUFRLECXTHPUNKLIMKYZWTSWIBH ODCITPVBYSNLJKJQTPEOGFLTEMRNEALZHXNOJIRF GDRGNDFPVBGDSFYLCTMGROTUVGPMMSRHLXUTBMJO XNELYNDNMXAESXUYGEVRKPFICPLGBPEJXDXPVICW UCABSPOPQBRQDOSRRCOVJGLVEHVOGOKUJNXSSLWL EPMNHYZUCGCFYEHBFKHOSHHDIOHYGZCVKWFLXRCG NIORURMKTIEVAVBJRVZDIBVOOOGZJXLCSMJYORME VGOAIXMHTRYCITORDFAAQFCDCVFISCAAMZQZBEWY NLZGDUNZCYAWUFSDVXBAGFMVEPVVLHYEPPVDXPTM NXNYRBDEICHBJOPSOHLXEHFSDNQUNQCXFILVTXUA VXNDCGMXCWCOQZIVEXSDJJAYUGEKHVPFCGWKYDWY YKEBIPMPLJJLMOUCYPVANNXJEMEMJLFGRHIRCOBE CAWXREKSXGGPJFQXWITK
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SPBGWJAHDBFWJQKPKAIABGUZKCICZJOYXEKLNAGR GYEVLOFENFHNVAOIOJLVQAQEEIZHMTKFWCTTANXX GTRPWJDKJUMBPACTTNFRCEAYCULSYJEFWXAGOMWT QHSTXYJLWAGBQWJGNPFZYAVZYZSFJATFETOUGPOQ LHSXNQTFWXLXHREOUWCFJKWNRSANJMEIEQGAXTSA GQSYHHCIVKVDMUIEUCWVQSXDCNGKRJTSFXLUMTXQ YRIUGQQGPZPQEZIUHSBCPSAOLUVQMTXUJCCYVJDY BKEPZJSBGUNMEUIMMRNYOLFIRYOVZPGIDHNIGJBQ LWDZSFKTZOBXMPYLZQPFXXMGOXNXSXVYDDMKGOIW JBWXBALMGXWQXPAHXLJQMBHGDMFFAZCWHRHMRRDY BBVMGRKUHCBIZRSSTZPWLXLJHSQTNVSJBMCXFHOC ZGCGKQCRZZFUYZXJTYTUNNISFIKAKRJSZBEINPUA DXHMMQBYONCTXZTLWPKJIEOBZOYZLUMJBUFPFDJG VIIHDCOMURBGTAOJFULBCJVVIXPWHFTMIPRMGZXQ CGBDGIDXJWLZALOIPBWQWPQJPLPFUSYRQHVUJHFU WFKKWAMHONZICHDMMAYCNEETIWKQQUVBIOJYSBLO BMKHFZZWXGCAGTOVAPNIEALZKOEKZLFINSYPAWMA TTHVOAKPVOYLAFOZTOWJNLTYLSDIXIPJZNRFPYCA KNGAFSHPIGTMNDMMEAQOOAQUOOKJDBOHHZMIFZKK CHCFSWCDKKFYYVCWFABWWEPVPZZZRILJAZNVCOZQ UDHOANYVLDOUDCJCTAHICWQDHDWJAMAYLRMFYGCR XPPMRFFLBFBHQQQFJXUKPBPZPJEUJRSFYNCPPXWT LLNGEMCIFTOESEJWJWHICDTMZGOAXHSXNCBSAZTD WZYNIHMGUBGFDSVOLZFHVOOKGRMOMHHKVMXBIQOY SGQPWQYBLWHZQKECIPAXMKOAWQMSZVYUQHIMLPJD XDVBPRONMGBKBHZCEAKHSBFUFMCEBDZTOOMISHDX BPSNXWCDOPQGTSCAYYDNPMUTEFFQCWTGKHIXDVWH ZNOCXHJGFGOXCMZWXQZUFUDWYFHMWNZXQWGZHUFM EIBJYBMCYKIIFAXNMDCARHBIVJUHWERXCAOEUDFD VJRZYHOCHDVMTDLHHKUWNDBTXXFHXJFNDUPIIAEA TWFNQDZAOZRSXUQBTFFIFFOVMEUOXYAZLRXMMZBF QDOUDSTLZNPFIIEKRNABUGVWEDIZXQJHWFFVQANC QJAYFXJJQWOMBDBNFRXLDMPJUPRWHLCSSURSZNEH GFBADRJXGCQMBYYDRKCCPGHWUZAVKFXZITTIJUCN YCYAJMGERLOVTJCXYZFCGDUPMIPVVOHSTXCSCOYX TMGLQLOBRPXRSVWIYDBABZDNVTVOZXHWSOZJCJKS ZKGHYDTBFTQVZJENCGKSMGBNKLYBEUFRMFKMVYAH WSOBBSHZQGVTJJDXUJHBHUIMLHIXCLWXARWIYWQK ZJKTZGKUNMFKFPLCQYUKMVZPWWMNYLFGWISYWTEJ GCCURUMPVVWMDRHOTBNAVOTREJNHZBYADIYEMROY FQMMBLPTZDNXGGVSXAMZNICNFACLJEIETZVXHQRJ MUXQNPJWXDFTQOTJLLNTEAFETWMGWYTNOZDMXLWI FQZBGHMRIHFYBQVYCKUXHOHHZJNVYGTHKFTFPXDL EDQCWUVDANPWGDOGTHYREYZJUNFGWNBVOZIRMNXH TZMAIHIZYZSTLMBOQFKVVEKPTALPHBSYFAOMMGLA QLVWSKDDRUAHAQXCBAHJBWSJKFIQDYHJEOHJGPGI VYKFGJTBFEMHWAIMFZRBRCJSXJAGNYZDLLJTEYCP XYVHYGAMZJTBOAIPSVIP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      THJGMCDCSGICCLHODEUEODIUKUUBXEYCXPXGDITC IVGGJEWBVKNLGMRARYSHKJCPDOVOYJGPYMFIUTUY TETKAYESERLPQWZWXAIWXFXHDBYQLBZTKSWUJKXH CLUCWDCWYNLEPQRTGQXQXFGGXEPJVSEVSKCZXVIB KARKZNFDELUDPKYQTWUHCKICRJGFRCDBZBCUGJGJ JIJUYJRUKMCFYVAVFPRYVLJJPLZCROWBOIADPZLU NRPEAILTYOAGWYJBHZMJWEICOXBLFEHCOPABVHYD HUBUGCEISEASWRVKVFSRDRVFABFCGWTKQXAFUMHD YRNZCETPVQSNDOYQNAVQCKFPMBKCXXRCISYMNVHN GENGZDYRFVSGYVYAZHQMVDXYZNEDCTTLXJXNBLBM DOBZAHSXRIHUSFRQZJWQULIMEOPVXJLFZKLDOVUL ZKWRYIDSRXXRVGYMWLFKQWZFNDDITEPZAMYWFLLE DYDCFJDSJARSQYAYQWOCHKCBKMAXGJFABMJFFMMN ESNCKHBFHNZTYTVSDYAJIAMPATIVLLJDUEYQYTCM WYFLRVBFGHSNJBCEIFLFVRVVSNROSAHIXMSLUKEL ZVWOIWALTSUMEGNANMMADIVTVKPJKSRZBBATQCOQ PZGUSRRHXPCJIQAHWXNZFEKRHMYXKCFGLGZNCTAP KPBXFYAUOZPTKMJKDODQYRSVKDWXSQHYRLXSKYGS VVFNORFCBNCZUHWVQVZZWHSQUNLXCGUWQQPTRODL VBFLZGTGUFRCTABAAXBXRZKWGQDBKFUOXQPHBPFI FGZFNKREUYRYHDWFFFUKUTLUQWLCVOBUIMGTHZQO HWXHXFASSEQYQFTJFJLRGPCGDNMZSOTMMBFISVBP BKOWJMAWVPQFZIPHQLGSJMITLCIYDEDDPMDHKDKV VKTKCIUWLPJOYQOMIPICVVDAMLVOABFFCHZMWUQQ XVSKJOXKSRSBZFIOVHSEVCHSWUBGZHDSMPUKTPAB HGMKIWMJBTCUZYJMFIDVTZKNSUQCVAWRMGCFZVCU THNESLGLLFNNAXWTVSJVDGLMSFIFFKUNQFXEPLYD ARQGDJUMXZDPFUBUWGSFPSVIDKGHEIGIFNNRVZSD TMAPHMCVVZTEMLANVQABCVNDXJXWDOFTBHHCMPOX PNXBBHJGVERPHAZWEEPYYRXCMFJRWZKFPJBLRGQA KAIMOEXILMTBUHMUSYVMOKRYOMVWFAJSUBXHGSRH WUELJYMMVZQWCNCFPBZVUQPVMGEERJAKUAOQIYYQ HDOEENGDEIPGGEQVJWZUMMRBXLXAHAKZJVNBCMGU SATZIAHKQSNWLOOLJQUPBTYNKJYUCNJDWABSSXSO MPCJHHYXVFFYBLVFATENSEEHUEWZMWXBSQXXRXBY FJUUUIQZDAGTHJRXECBAMXTRGVJUUQUOPAWROAHT TYVPWUOPTCNQNMTQXJEXEGCUYGTQIWNUKWHHXCOR ANXFSFTXUNCNGMYOZOXLWNGZRXNGBTTFVMFCUHJC QQRODBJLYQHYKKZZGSPUTFPMJJUPBXNXNEEDMUZW ZRESMDLEUYUIJNFEQDETHHDAYDPQQCBHJRNTKPNQ ZDMNJDVPKMHENJESOOLJRTYKIVYMCPEQTBDPLSJU FIOAKQXAOMBDDNQFPATPBZHUAIVQDWDIXXFSAWRK FDXSMXERXOUQEXIOCZRWRHQDPFJBTYQMUDUWOLCE RSURORHGQRAXGUDXCGWFVLHKDMHMYTUNFFEPPJWC YNSTRULSPIAHUZIISXFITZNDCBQXHUIDUPAXVVZO ZBEASVVKIXZAAFURKNMEBBQIKUDUWZYJIJNJMNIF RAOBKYGACLICQDLUHRZCLYVTSEVJZOIZSCDXGYUY BVVTKPNQIKCQROYKXNKH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KLXOCJXLHEAWZVMUTWHCFNKVFWTDUFIUURGSZUEU TZTUBBHLYVADXDHSURQHNJGQEXAKIEPNGJRINSFG RFZXIJUIMCPJWRKJLRABITXQODKQIWDHAEHBHMTI MTJDQAGUXLIXYRLAOAOJGQJVAXSFGKWEBVTQUHJL QJTFYINXPBMNHNLGNQMXCRWVBXPHQEGBNVGKTMIC MSDQTWKIQLFRDQWUQRXMQJRXHKTNCMBPVLLTYSWM FUGYLCGAFGISKXMUOCRXOCBBYMUJHLLTMFVVIDWX IJKCBYKAAMNRUGTAMCJXQEXBPWDYDBGVIYMIVUYG BWUOBXYBFQMFYXIQYPXCNRNQRRERSIBKHKALRAKR MSHOJWHBQZSBZCCLMDJVLLDJOSNDLMNAYORQCGYS HRRSZHQZVCYYCKMDAKJEWUMNURCVMROSAOPUNEGR GAWUHVYNFWCLNCUVPIBCIWSZPVTTFBNACWUSORGL ELOVOJCYQWEMPCGUEMZWDXJSLOKJZMPBPFIVKTZT LHPTSXGAXCVUAENZJAFBMCXMZBUIMZBMXYHFUWOW WMMPDRKEDOAPHLRAVCUHWTCNZRBRMDOBRFGFPNYA OKVVJGJIWGYAJONKRCKIXAVNVWKAOQUHKHXWTIQW TAARWGIRHALLKIZGXBFVJBYAPYEHDURZFYBGPXGS ZIDUHWNNUCLRRQEBIUNBFGCAWAZURKROLMHLXNWF MAUZDJWZXUPMCAIOXDRJTIZGPVAXAYKHWUNNJHSL ICXMGFCOBXDCHNARTDPUMSTZBTQMYBRSQZAFJRTB ENTYDAHDEAZVECKVXKVJSMAPAXOIKKJBUOXFENTC YWKZNXAICDMETTSEONZVBAOTQWYNBAGWZPFYHKRK WDYCQHYVYHGMLMFUBZMZJFLSAPTFBCFYBVRYXWSG IZYANVEKLWDRAIMDEMEMRXJXYBIZSMUVSHNNPHOV SJUWKOHXAQEBZHGLLNRKCIUZPMPJTPHTRVBDHQCB DKJHWLBZODCUHPCXBOIDLPDTPYWMYALVWFTESIMZ MXKTGUYFXLWXQUAPISNTLLZUVYYEOQWDGFFNJDCH UTFEGJCGDGSHAJESERCUDNLOAGSANSACDIYSNYAL JOCXHJJLKZFCUYFSLTWCGBGGSWUFEUSESCNSBBXS DHDDHSMUXSPGYGKIMESQISBMDXZIHXCNBZMTZNXL STTXUFZVRRYFEWUTWFWAITDJFPJDMVHWLZKXCATD RIOAHXUTWGTYSTZTIMILAEULXCPYJLGEZEFODHFF YBSTUOQOCGHYVUGZVTZBKUYZSSPKWTXOPXBSMTEJ ZOCLQJLCCMNQJQAXZTROKAYHZUWSSPNVMULBTEVA OQXATBKGFLNTJBUGXVMGBZCZPARLBIGPYMWLWLRJ OWGOBDYPEJYKPYYNMCRCSTYEPIOBMIOCODFVVUHI TWLBDLGPYGZTGVUPASHGRPILPGRZVARAHAKIXWJF OUAKWSQSZKZVOABASCHVJAHZGPRMDMGSPHREJGOG BBEBSNWTOHKFLADJNFOBKAHZVBNNUEEPXHNPAKHN LFSZGYQCWGCBYTHEAUPZKAADVKLWNIJXOYCLRNBM KKZUQKPXCQGJFHTYPSHXVGMHZSNMJGSQURSFKOUN AWWRMVSLJZGLMJDVXEDYRPSTBSLOVTWWDXKOOQWO BEHUHRNRSPADWNPNZSKHYHUSVEYTYKJUOALCSJRH WKWXAHUWXSJWPASLEHZJJIUXKKESHFTMIRNUZGPR YPFVPQVBZUWCJKCEXCVNVXGOZTUCZHBVPGVYEDWE KUXOTBBKMYVHJKIBMKKACVVJSZUIBPCKBIVVSBBD LAEEILMGGHCGEVMZUXRRASJVBGOOVZUUMFHCGOOK CVGKWUSIIVXAQBPCMKDR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      BSIHBMEAXOIRCAKWAVUXKADTFWHPHYLNCFVOHPUI WNQQSLUFQKKENEPWCQYMADAELXVXBZXLIDTGHXBQ LVQNDPYQTGGMBVMPRPQFIDAAZNTVYSATNZGDWWYD TSOZQZFHWONZSXYAZAUALKODPZZQNLJQTTVJYZHN ATDOJZSNETMOMXJEKYEFGMJXMOPWSZLZWGXFZUPK YSKROLIXWBVLUCGXDYLLAXNCTCOIJLOWFRNPXWCA KRJPLPJANJERYGFSITLFKACPBSDAFIQXNWTQPAET TYHAKJOYJJDILNSACWQILCWMJQLGSIYQKYJZZMFI DWHBQAOTLKHDHELGFVUXXPQWGPERWOALCAAMILLR MGADKGABBGBWCNUMBJRSCGXCPAKPWFOSBPZSDIXE WGDZFJBFCGTVQDRVVAPFSNJWKOPGGGDMQMQBPQAJ WRYDLUHQRZVJCEVLYSFFFPTZAIKSLFZTOEACALCR QJGWXQAPIJCNTETSVWVPKMBRUDFQTEIOCDTIOAJV PCMIJUADVREOTETXVUAXKUYZYYOQRIWMMIZTZBVX AHLUIONBJUKFPTPQMUYJGXLLXAIDUUOUBJCDOKKV DHVEYMSVZLZGEWKRARWGCIDRMWEYISICKXMNSQIC EBBLFVCIQWTKOBNXLLNQRMXVUWHHYYFQWUTUKJVZ GCUUUYFAVHEBNOMDKNXQHRFLBMUDDRVWIPGKMPYG WOMWKZJBWPHHQVEZVQTIRBIVMKYXYAIUTFDIKSRK MNRORTWSICYQTFNSFGHGSYVMNCBOYJJTKBCMIDUH HMCPLFNGEBRBXLURODMGUBCHMAUPEHHGKGNXXVIV DAPOUEJFQLSFZSQGVUYZQVFCJSLMIOVYXDMHLWLI HIMJWTIQOOPICGHQEKCJOBEKYVYIQYIHNMIQFDTA NJXRGYDASRLGZFQWYWKRBKSHAIUKKCJPWNDESUOU VOFSVCNFBBOOGXKWKAWPVZBVXENERQGYSABSADBW AOWBKMDAZVIIBSZHQCNTHUQBMZMNLMQIFYXRAERF RNMCLZSOCRFUOBTJPHRTFFJYTBWJBICLIEVPCPJV VOFUFJDQKCOKGITWPIOBBEKGFTBOCUDZEEEPTTLU OEACQAHAVFUHWYKXHWSVCWSCJHYFVZBJZETVIQLN QRKKXGMBEXUDRNJILNFXRPKXSRGLANPCYJIBJDOH SZGCGIMSUIQAQLNPGVBBICDGNZOPWCNEDCOACQDG GAFOAQUDXBNOSMYVWATKKDBTSBVAUHORIJOOTBXP AHFXBLJOEACAPHGDDDKFSAMCKGPNAWSOUXECXXDC BAQNFZRPHRJYQXPLXBLYFSTRZNXETNUTJYOZKSLY PGNJZEJMGGLHNGFNFENWSMFXBFAVHXVJFLIKWHFU ILPYPLJIRZJEUZYGSEGKMYPJHWGWGTIORPOYCOCM YXZWETKMAXXRZINNRIDDQNOXLJBVELUNPICQIFSM OAQBOKBJHIAFZGIIGAULGJAAQQXXSZEOLCKTSTZC FNZDCTUUVGHWCVKOMZMYMKLEIGZPPYXLVKWOPSFT LJKYLFPHOFBTNHRRKAVEOYQCGLEVFMSLBCWAHFBG JAIZNMFMPIXWBJPKGPOEMVYXMQWEXNEKIMEEXFQF TLOMIQXTNJJWYJBUWMAMTJIGZDTFZLIKGGEMQXYF DRPOPGOXGHOLYPEBBTIQRSJZSIJFMPMCHRMEDECA BIQASIRAAKGHQKEJHKSLBJTUNWCYCEGAFOKCTDRT JWHHMISWMSEHPIWDPMSADZOCBDNELUZZDHDORZQQ FSCLSSSAIDBCKJUTQRNBEXDPBUYUBTFPTZYUBETR TMOMAKDELQUTMYMRVQJLACGPTVLEGSFSDUYXTPIW LKNICPYSXXKOQTRANSAD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RPWXMXACGPHFTRVOKRKYLHSTXHRXPNZRFOOUXUBT KYEUSCOIWITZNKICAFZTWITUJZSUKQNDGRJHYVUP JSYQGONOBHOOMJLCKJTQFNEAKUWLKZALNNJJLXFA JTWODOKOSCNNRVXPEPSDMGDKJOJXBNEYTTBQWBIM EYHTBVIXASNELWTEMLSRBKYPJMPNQEUFLGVEHBFB LFKPMHNDMUAQYPDHUEFTAJPVGRRAHULAZMDGFFSA SSHPRQHNYTRLPFOXIYROVXXVZVGFGBSHKJXBBNIS AZGZEVERIFYZUNDIEWPOHDNNWZTRKJTLTKZVUVMZ PWMDPWVBKEHPMLQSIDVEXVAGWXTRUDDEFNKLUSGS UTZONZLPXVGUOBPHFIOOYPXZXWVOVSUGRTPXLVGV KQABIOFPFBFEABZZJNRSDIJNSXFAXEBFGOAJNMXN DGXMUXRUTHIPPDXHSWIDAXOWKEGLLLBVTQMOESXE EVITTBVWBKTYANXBXQATSZPYWTWSARYAQDCPAXCA WMWDEUYSCZDWXWNQIOLQGNAURKXUJPOCISFWRYFA KBEDONBEFAKVGHBKCMCURZVGWTOQNKOSZTBDTDAU IUWCURABWXLZSMBKUTMVNDBDKZVSVLQMIDYJQWOF QXCBQKKCJZAFKYLTMQKWEYIZANGWGPSAIQMZJERI CMKTHJMTVMCUZEFQBAQSTUWUINYNIZLLYSNKDWHE UGALARSGHOBXTMBYKFLTCJOMSUUMDCPFUUZFFVSV VSGOYQJDDXARRLLATGMMTNCYJUCLHEIJBXGQMFHZ ZVNPXTZVNWNYHLWTGXZREOHDZGTUGKZRFJBATZAG AOSWPNDAKXHOIUSYEAISOIXCNZUMBXSBANSCMOGF VYTFEKLIAWBMXADCLLOMRNWQTGVDNZSYCKIUJOYT ARFXWYMOYQYRXTLSZTMFJNWQGISSDLPONCLZGMLR YCOYJESCQWDTMTCDBYROSRZFFAGPHOCHNTCKYOJG GGHAGFABEVUOMNDFWPMBDWBPCXQUVVTHLSQJURCG XDHLAIAGQWBFVUQWNKZHROLEJFUTHPMMQSGFULJK NWMDTSDUOFLJQFPQPLYDGZRUKJCGGTMHCDIPKVSK UGJWYYPWBQTSYOBOXPCUUGREMABTGQXQCAJXZGWC UYBTVQQOKPOXFUMCGMYXPOQXEGXTLJLLCRYZZWCY TLXROARPAHRKXEXMSOTGIMRUACYNVNVLQHQZHHYW DCBTYIWLRURCHCCDKNPRZBHTJFXWBOTWRHOUPNVL QRMYLUWMGBOGBMVKNJGLDJFCWQXURGPDHIHPGBVE JPIUAVJIOPKZFVZEMKANDWURYBOXDGZBAVUPCUDD LDMUDVLADHBPZBSKNTALCSHOPDFZVAXNVNQUVIHO MKYEFDFFQHMPHVBWAYHUOBJTRHQGZHWYZNHTPUBW SYNTKCHAWVBZORINGQHEGBYSTYDKMGKPUGPKKXUC GBFVKOLKLDVQUNLBIFPUOMVZQRPRFIXLBZSPLGFQ GDELYCIHWGMNBCZJAMQAIDIPSTDZFFYDPVXBFGPJ EUPDEZAKOQTMRSDNELVNCUVOJTCXRIGWVMUQRHOQ IFVIRVAZMDCUCDLQMBHRLHSUUEFWKAHEBIRYQBUV YMITETDDQLYNBUBIFETSFLEWWEMKCSYFEQFANPWA YJZRACDNEXXCMUIVPMCWNUOOVTCZLNDQDCORSYPE FZJYEMIZIBFLFRHEVIOBZBSTXCGTXWQZZNSQGPFM FDZWSKFNLVCFOGHFUMLYVBNQKVELWZEVUHDHVLZL DGTQPVEDURUTRREENPIERXBXZVOKHPOHVSIIAMRA QLFPNRSMUFFBZUPBKIFERLTZIKUDSAOLKGQYVZBR STGDHZQBRMKYFJIQRHKN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NVKHEMBXEWJAQIECQABMXFSOXUUVLXQHHYDTIQCS GBWCHBJSICGXJSTQBMLSPCXUJDILJTDFGYCREOJV JUCBCDTGCWEYJDPVHGBVTBXHZSGMIZNCEICLUVEQ AGOILSOTQTSNIURAJTEYRCQPKVOBFUDZPFTKVSZL JJMGFJJECANUMXYIKOYWRFUOIYUUXNCBDYEMEAWF ASXLAQCYOMGFUIJLBQRDJYRHZMETQZNMFOYCDMMC ZJPXIBEURVEOOMAGQBACWSHEOOJRKKLHLNGTFRZO HRFZEQVNYPHUPVMHZUCALDSKYJDHYSSCVOJHXUXR VMNLDLSILSUBCTBOQOZOVJNKNWLAZYFUHIQJYISX VXSKLLLDBUXQSKDNASTYIAKLNBCKBTLJIENUTPLH ETJHURYCUDKZPLJMIZTLSWAWJMUNBNUHLDRIAJFS WTIPHARYAUHCCGCDXKSPVCOWZNKWNXFPVUBGKZVY WKOSZWJDWFJYHTZXZRISLSARAHQPRKKEBYOQNKPZ RPWIXXWTVQMBKGTGDDLTOOFSLMDNRIXPTRSBHEAK QOOJTFZOTKMFKHAZSFKBLKUCAHYKJNUINJDWWJRS QBGOYHLPTMPUCVDFKWKVREPEDUIPMHMGULZZPUXM ISOQZUGVGVCBDMMGZFJBKQRHYTBQUEIKHPJSWBLS KEFZSEGOUTHMNASRXTUBISMGCOYEGQQYGJDOZDVD JNFNXYXGLNLNFOPYYTSEVZYBDIYOIDWQXPJPGFCN HMOMLKPLCVXOQPFSZROMXSWPHBHFJQAPXSSIDXVU OTWOSRRBHVTKXCLSZISEPJORWGFBIRUCQKEFYVDQ CHGAJFWDHOKGJSMWFYDMCKOTVENAKLGVLZHROZRM DYGQGDNLJBPIYXTFVPYQLHXRBLQRHZZJXSWIRMZB WCZOOEMJLUXMMQZUJOYXRPGJHRYLLNXNAKCBMRUB VNGWHKAGUBGHHTCAIHHYDHATNUQJRWUOYHZWNPUL PGVLPJNKGGHRARUKFCOWWQPPKYZXEENEJOFLCQHB YQLTXGFLSEQFAJPSHBMRZOEXKFGMVWCSEKXFOHVG PDRZHAKHWUOWORMLBIPWIYXVRGYWXKNCKNMKIHNN FGQNLZCCEVCVDQPMJJUTBPZGAUTQBMKSRXVZRSTT FNPEQSTKJMQELCWEUHOVCHHBMLBJDNSNFXFQNNIM TRYSIQHXWTSQGUMVNAFCOXFEEKQOBHWCMAMBEAUC SJGQKOTQSVPPOLTQGREVVHFXKPDUXADRACIODPXF RQEPWMLDJQZOUYGMRVRYJQBNLEPPXWVANAQPSMWX WNMCEWCHHOHNLAIAITIDNHFUDSHQLWNZJCLOOUSB NWIAKFTMTLRDQCLYCKPXTEDGSTMXCTTYCTTTVNLQ ILMGTYIOUVZYCFSSFLZWPNWBDGHVVEHXFQVOHDPU SHTIXBVEBXMLFTWGGSYKPWPJGSLEKAWDYBVMUSQZ MQELNUWLENEDHUYSKMTHQPFWNNIHBORKMMLNPMEV FBNBWYDEDUGANNPTOXTSKMSNMTWYALXVTRYTNFFH GJFWBPXYIKGZHTLJYYSRFKZRVCPSUKMFYGWWRFOF JMKXCHWUCWZFESJHFCEJSTMWBJECUUQSWVEHSOXC FNDYVIMBUOOZSFHRALUMZNJCTIJXLEICJHPPNKKF TGVDDTCFZAFQHMUCHBEOYQHELHTUVJTSYEYSXYRA LDFRUHDHNLJYZBDTZZRWSRZZMIFEIBAFGJVVCMZZ MVOUKKWUFCYGSGRWETMBLFDIDHQAGMEOAJRQVRPB ALPPFJKNHIMYDVHVBBPXIPTERFXWXTYGBLORODLZ RKIDDKYUJBAAAXWICXJXTPAKVOWLTNLPOCLYLAXN VOKEILZKWYYGKSRJKEEG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RKNAJAPSYYPMJSTJBVPQHQBYBZPYMRGTGYUCCTNN JJPKBCLUTWAMGRYADVFQQTLEIIBIYXTYEIOWPWXC JQCRKFKSCSTTYKQKBMZKQUDYDDBAPDEBWLNIHGIF UUPXSAXXYHSUJNQDTSFNXBGQUGVNYCOCSUOAVKAL TPRDPJYKNRFUHUIDOLGAYHHCNVOTQUXTQPXJISVN YFKJMMNOHEPVUCXGXENGOKHNQRXILKQETMXRDJMH WWPEFTXBAFZYELMLKUJZCMBUEVJIFQRSWCRLQIQB TSLZMKBZWPUDLIAWRDJDEMOGRUYJJQXHHLBHDJRE IBBZFWOFIJZJWCQZKQLTDELXOJONEHEWGVDDTXOV HNPWTMWEUBIGAVJHHBVGPEZVLOVCZUOSJACCMJSD FTTIJEOGCZAYVLEVDGMHLOIZYYKCACHVAOCVBHPD JGLDBFIKGXEEQNHPOJXCELCZHIZYQGOAFXAGMYNN EFFVIGGYTICKPIRGCQBQAQYWUNNCXNMWCTGRGWAI BMUDJPRFUDTUOWLMSMKPFFLJWFQFLWAEHZCDTRYS WDPACFVNEABFFNMMCQCLZGRJKGCPAISIBLAJFHHU DTGDKIKAFOIQFCSEJRWVPTHCMTXOEYZJVHIVIHNY UFSDBXZKMIMIWDGRCETZVCKKAIASLBUKOKEOEDVQ PGNKWDIBBRXKJEOKNYSSDHBJGBLTXRJAZDEXOAEB XGVCHQRCNXIFZYMBVOSRCUFXGGYNBRBOJVTILOAK TNYMIUTQLQBQSBBFLJSNTRHTWCLVACRBYNFDABXH SPNGWYUDQMYTORMBWAYOFEKKXVRDWYLTGTBEJSAZ YXFFQSVEGCLJVJAGDPGTFLYALYRMMYEQUHSKJECO TUHKVLYUMHCJNECVYDSQHTBWZIJOYASFBAUXJQOM QNBQJRWTPHMVUEDBFRMEAOUNTMJNMHHXXDYNYVGE XMSLSOXBREYTYKDZTEMBRAXALJBILCQPRYJWJAMQ ANNNYQEFBFEFJUOZLHJNYIMUQRJLIZUTMXXPRNDZ DFWUYXDFTGTEJZKDMVJJGHNPMDVLCONOZEDOJEFP JQTWAHLHTCQXPLSMVKIMZRWUIPRUWQJDLHYOFRVR TGWAHHYYPMLNRJZHIQNCQZYKTGMYWSSLUSYCSARF GMXNIMTXXMVZXTGCNFBOBNQTJDYDNBAYUHEOETPQ XGTJOGQZNKPKGKTFTRYHZCNZLYIISRWEWHWPHCDC YLQCBHRLOKYGURZPZEHMKRLQKFRMMUBYQQLUTRDK CVOPJDNMUTKIALHWRSUKMNWLVAWFMPPRZSOWUARI LQBZODHNYVYFACCFOISMUPFUGCUTWNTOECIXHFSX EPXMYHQBQBRGNGCENCOXSLGKQLNWWRWDUNHJUXOE RXQUOGEXLBAEXKSYSJTSSNYSWTMAYKLXATNKQMQH YCOUCMBAVCQVFBLWBMVCZKMMRBPEQOXZBNUVXYOV RLVOIVRYWHGWEYCKPUJZCRXIWSVLRABKVGDXKAWE XZJXCVXRXAVXTKTDIBRPETJGNBFAFMYURIDLOBWS SARPYXGHFEGLDQXGWVEEKZRYWQHVUFRTQGUAFHLU EJHDNDISWMEZIUQLEFYDECRUGECODEDCPDDFMPAM FEAENEYPAKBVDXQITPAQCLEUETPBHYSHTXGIKPZV PCBSMWZHHSLDREWWMJRYGHWXSTTADHNVSFWULSZO MCIPIDEQYIMJUZJIERDAYOEPTTCLYOFMIGZHAFVR TUZRYQGMSVKGGJHWWCBPFZHSBSPFIUDWJXBNOBYD FHNUBOGBLVOOPUXWIKFWIECXPPIOSFLHKNLUPYYP ZIHVCESIWNUHICOZMLDOOJUFHXMVCQOAVXNCEWPW URFSCBIRCAFOIZZGWCWN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RXIPESEMGOCNYELGWZBHVZXAFGFWTJYIXZFSVLZE ONIVQBMMMQHMPLMJAXYHFIOEJLFCLEVXTBIIFVTK JRAREQWNLEWHZAVLAVPEYHRJZYHLFHKVVNTHBVSR YKYCGGEVOECBNJBKGMXFYECPNAJDXFTXTZOMLZDI VUCWUEKIGBZGILIWXZQNCTJCGAOAYYOLYABEPCHN TYQEFIJWPIWHYXWRKFIOBOOZWWBQYXPUCOOPMVOM ODFDYNXZNRTSRGELLQDFJGAEJLICLBDHJZJPLITY BEYDGLTLRQDGIKANFDIJDDSTHOUSQSIEXKXMVODF IQSNJOIYKCOQNRGYWMYMNMWPCSLWVJCWNRIZFLXW HZMOJSFGHJIIKXZYJPLWXMWEXIRHWKQQOMTYHLES RDITSYYOELLSQNKNKJGXUFXJGOUOPATQLTAEIDWI KDXNFRIXXXFIRLPTMRAFKUYYDSQDIUJUHCKPVJDR HXRIELADUZAXYBTFKEFFNGWATDSAALVOSLZJSBSY FZUMDEUPTQHJTUDTQJZSKSNIMIMNSQOOSLQXFQDL PCHSBAUWISKYEDQTHAIYGGIVFDOHZWCODSFQQIUZ BMAEPYWAQHQHLOIUPFSMKAMTKSGQXCCFFZVDMZUF UCKNKDROIPFJEQZTBZBYDKMBQLTBXCOTBYPLYYXH BAYGPOAVOBEQTEJUAXWVYVTYDMATPPGQHKAIXWBM EOFHVBVFBEAYDSBMZYMRRFASKMSYWRUSBEJSPOIB FMYFHKGCTPYMEDQHSBXABXXNGMTASGKYADVHYCEI OZUWTVWENTJXTPWKFWNHUEEEWGMXXZCBZILDFKNY QUSKTLJJOCCRNOXJLTEPJFUVEEYOGDPTQGLFYRVI UHVGVLGGCBUVSLVKSOEZBSPOQTXKNXZLUQDWNEZZ VFIJBNUTRMUPBZGMQHZDUDNVLVLHXCZFHNGJXARP ROSKWCILGRXGJEVHTCRPUTSBYGXMKPRHFAIVCBVW KPVWBWDSLEFANXHWDGDPWUAFCZSVRAEISCCHKIDL COOFXCODZMUKSYOMEWUFZFMJCSDVTAUUWCZXFXMN IBTEDRHZLKQTHRPLKSUKVDTXCUOWYSWWSMSZMGCC AZJGZQQYDGBEWVTEMYFVARLVORPYBCVWGNZBAODW NMNLSFWIULLUJBTIJEUNQUOQOCIGZGMJCKJJQSWL GNDLLZMLRBUGBJGYQEAYSMHNPSGFHZSQPJRNKGCD HOEAUBGJMGJEUPOLUWJRLLATQGYOBDCEIWYKJVKZ LAEXMSPCYTPIYXRUMGEUSBGZUGFEYETAHUYRYKFP WFIWRLLXUZOPOHOHYMTPGZWZRBXVPOUBKOXLDEZG LJVGWGUCQCSKEFUSYPKUJOEGYSSWGLSLNBYUFWSE LMMNYWBHOJRYGYFCVTPWMWZJVKUHYSMCIOLMWGQV ICTMYDXHLRQYWFSRUEZBHTECJKMCBTEJVSJJRFWF ZDKGNWNUSNMAQCTTRZNTCTSXMIREWEMSQTVYPUIK HRXUIIZTIGRHSKYVFJBLFWVLULIMKBDBNBKZCYFZ RBTSXUGKETMZUXDRVCRDWZUROLJIXRFBIQMLBHLW JGKKJUGZHWVKDTFVSLWVVAZEMJXLSFFLXNTMSYHZ XOCXYBLRFFTUHXRMKYQUZTBUJGSVKTBHOQCGFXWY HLMXRXUWMETKJCKCYROCSTIVRBAOVYHBDHDQMQWY WQGYAQDHAYTGULJWZLXXDKIYFELMUYGPYLETVIOE OHPSWJTKVJOYJWNDVFFVSQCPCRIHWMHDQZVDEZMA KMORRWIESURQKJUAAITEKAGWFYMAGSPXQOCVAQHG RKKTXZIPWCYYLSHIKOYYRAQKZLXZBYRVEWHSFRDP MGQKNXZCZXISZPNUHYGB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      VFBNMMUTUVZETWCSAPZYHTEKAUJUZZPSKBBQMSKR ZAWYWNGEUCZAAOHTJPYLGNJNQXKUEXTURIENEVUK YOPOJNUWSVBJDRPYQVVLGKKMARLAOLRQJNGWPMNR RFJFPRXPFBTVHQMMMRRVMYLHBLOAQYJCDLCCYTST RPTWNNCMYQZOQBHGNVUNVXYAABGPLFCQDMEZPKFE VAXRXTJJRZYNWELHRUOQZGETCZUNTHCHQZFWTREN FMGVCNOKHDOULNXRZCNRLUPFYQCYWFSUHHACZUBG RUPGDMXINLSPUMZLLLFMSNMSDBLNXMVQLGEWSSKN ILEFGKIMNRQFPJRMWRECSZIQEBBXUZXOXUJTIMAL GPQCOCVNHDFDDKWJRKVGJRJQLYXTPYJQLDJOYXXA EXRNMABETQKPSIBBUWUAKCIDICLPULYXEZIPHBYI ASPDCZKZDITDKDULZONSRSMOWIMPUHYWQCYIMQSQ CEBGAZVLODTXXCDLHXNWOEEMYLLZYQFHAVKJMXTT YFKKNEJOCRFRFWJAXCTBAPYVDILWVOLBWYLSAASN JTIJEWXKKPLBWMEWGAVCWFQERRXOMXFQKIUCEPJK GEVLQTGCFSTTXYMKFRLNMGJNAQYJSXLBRKPMXFMZ RGHQVCFHVIALTVRBFIKFTETBMXWQNBALJNVEAEPL KSOWHXWFZMBWCRRLOTTPZWJVYJHIGLSZIBPTQTTC RKPPWHZLIPGRMVYTDSDNSZCYUCOIZBJNMAXJVPUK HVXXKKTDKKHLLMMBQTQDQKMOTZKSEBAHESYVZSNO CZWSDUEEEQYSBQRPUZKMTVRXYMEOHTWHLORKKFJO ZDIBVOYOTNJSIGEGLBNMIZFJABDHFOEREKZFZYFL VEVKDPTWWHTNYKXURROAQANQWLLGFCMLDTQWIBPY EWPIOKIARJLXSJOAMNAFAJNXIKOLOWMDTPIWOJIM ESFIQWZUCSNPTUSCHFMJSVJDVXSBBHMGTHRKWHUA TBSSOCXOZMBXTFLXUXEFGLCTOMDDTBSIEEDKIEOP MVDPZCCSUHQBFAGNOIIVJPLEMXOSCUZVDMQBVJCA HRRNBHVBHEFJTOTXZVUYBHMXCGZQNNWSZLWSLCZZ KNGDOZTTIGKUWVUEYJUWLOCEEKXNHLQKZUFFTRPR SINFRWLYXKFREUNUYWNFKZNTMLVBXLVUJNMURGGL CAFTRJAZTIFVVSOCYFMWRLVKCERYTKKOXGSSIRXM CFBIIVPPVFVQONILWMUDHVVQTCXPAXYQXOWINVOM WMENGCYTEANZQDIWDDTFGCQOUWYEZUMFPIWRNGTF JHHOALMNAHKXQUDUXGEZDOSKIVLAWDFPVZDSNWRM PGWRQVRZXIDKZXIOBYLTPDEXHDPYGGCYDGBSDDHQ OCPCWRBYSQRGNPSFNISFPSDXEPKTZGZNTGRLBGDU ZLZDMGTCZMOOGLIZMTVXEIOSHVUDTMFWAHAIDTGG MYDPVKZTKJPCNWAEYJEZXUPWUJZTCXMAAZNFKUQZ GSALPZLYITNABYCRXJXTIHFXKRUPWXPSFCYKTXIZ JWRTVTLNQTOZAFXSSCIDCQCUIVCXDJGTQPRJCKKU JZFRZDYKCLNLRKJXDJDAVWUSXUWLFGHPPFLDFRRW GDBAOEUJWBBKUUEQJMDPQTFRCPELMXRLIWTGUTFG XZBJUEEKDGRPKODUHSKEMHKOIPCZJSXMYJKYINQY AKUWOHYVRYYRLTOFSBKLHDTYVDEMHFFFCJUNAPIK GDMIIEBWWWQOWKUQUZZOENZGLLFPSPYAJAICOAFS VSMPOSYTFEGBSIBVJEIMNIVRYSLEDXVEZJTTALKJ LTUNWKPJHMKGVRZMVSRAAJQWAAYDERLQTFWUZJAM LVVXZFMNGGSHHTXHOBIO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EKBZUUYZTFMKMJGXUAKKPPQHZTHYGRDAOFSFFAPU GADJXHOGMLJSAHSIPKPNRRTFESBQUIZUJGYAAUDN GPVVSYPNFKBUSTJBSGAJCRLINVHHWWUAMHYOXQFO OCYILKQDMXJKRFPLDJCTANYDGYZKAGSUGOTNXVZD ZBJFGPRDLVSRFZGLABYWFPPWSPBYKQMXCLKFOTHX TICULTTOREMVWDIRYPQLGEPOCQIIIYFFKKTLBPQC BQQHUBFSZVGYBSCTDKEMFEHGOJAAEXMNXMDLFPPH IWTRDACRCGUTAIXCTLIHTLPGPYONJPFCKFDXLUMA LFYUIDSKDIWPOUISUDYDYSCTTJETKNNSALYDIAMH UOKLBRSLEEIQTGLRWJRBYVZCEUHOMBYKUVBDPDTM EFUOBQDSYWCCQERCAUGCKBLNXNRMTDQEWEURMWWY ARMGNERBCKPJURGPHXCFPYGDAJGUGOUOSAQXDMWK NXEVACEUHCFVXTGZSMMMURAQKYUJCFRRCPKSTGSW RMADQSMHLDZXLVXAZEVNFFXWKARFVIRYAFRMKXHJ ZTCKJENPWKSCNFSTVYFGKTSIYNUIQIMVYULEREBH PAGOXKJGDTLWZEATDXRQWHPDSTEAXIBXCWLYYVJA DFPKBPZWAMFPIWFRAYKEXXEVPMDDVVUIGSVBPIUN FTCVQSVQSTSZMOGMFNJZZXNIXXQSDYAQAYKGPKWH PANNVKNEZKBFYNZYAMUWJTQTUAMZGEJUUVHZWHOP NIBUGMYZHTHVOOWHLIBXVNRDZQZPWQDTWYKIKPHF TNZQRXUSVYJKOXKGYGBONDUXQBNCCCITBIKJDNAL QKVOJQXTIKTKHGELCCXLVRQCYBBOTTAGDGEYPYBG FOZVBCLOUJPVBBIXOFVBVUSMGHWXXZYRSHNZJWKK LKVWCVBHJDYTEGNVHGKXBEXNZCTTZHKYAJUBFETA KEHPHTMXMKJAQPFCDULCSMOVAGLIQITBWGZGJOZJ HUUAPVAPJQJPHLJUXLEOCFKWULHGDLVMVLCSKWUD XKUDMHJSAFTIQINBBMHFDNIWVJEKAMLZKOQNTIZT GSGUHBCKTPFXWXFQRTOHKIOTJAIAEOLBHAGGILMK WQKSOCLZAZCNLCAOWBSKOAWXHMPEABLBAPVTJHMU QCMWIHVBCNLHLWCKXQAWSDRMTYJVRTBUJIQAZEBN IKPYFGBXVNEAFASFYYNXELUCGBKGIDIBNWOQYPEX DOLHARNQEQPCSUWLKPBDDKBXESQGMQTMIKSYWBTI ZHUIDCETPMLVZLLREJGUVUSNZHJXJUQCLIVFPLQU FCGYXNADBVDMJIROQTQHIVYVNQWYTOQJUYRGBJHY KWSKSDTKWIQJOQUXJRJELEDPHEBBUNASRQFSHESI LJFFRCIMDZUSTLAKJLGLMPZIXIRKKOHETXZBXBLD GGNWPPRWVFCSWKZGVLUBTNCTGYDAIOXVXAUHGXSO NOZODBBWKSKTZKWLGAYEOJJMXTJAHUBMSEWGMHLW YXAJHTVLNXDTEERJWDQWONQBBJKHKJEIRXUHCXFR FXXWXZCNJPCWNGNRFZJZHYQNZWZWYSTIIHCZJFBS OERJDRJIXQUGOVUYPHVOZPGPFEMLPLJDNHKBHKXA NTUWUSDQISQSWHRMAHBQTGJQUETUNNZZNJBRFEVW DOAKBXAHFMVDKJLYCVYREEYNRTWRGOXMIUWDKGQW UURMTABNPAFWAAPXDNQCTDJZGBTFGBMPRWMKSBHI FUFSPYADHCSBHVAFVVVZMBBTDPUSPLJANAZNIURV EKZUZQYVDWVJWQJJQSXUEXLSWWPCQZDZZBODULKE YEYNLHGZVXRVOVXJPPZINVXDYJYRJOWIMTYUNCLB FZKYYYIMFPJWMUNRNGCI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RZCUAHKRGYFGXXXSOTNODCFRICENYKACIJHMMSZK MWHBNGQCDYGZBVHOAGGWKIXJOMBBVLQASQXPNMTX OPUJANLGCFDAIBFZGDDOZJEEXYTNTLTRJXVSVTPH UMGDLMXGKRTZQFWRZZGAWIMCIJZBBJCLHKTTOJSW IJBWSQXDBWQPOUIIPGVYLBBVLFBDKKYGMNQPKIQP XLDSLTBSAJYIBHFALWAWZUWZYUBLEDBPKWESCPUI UKJQPGKTDLSUQHYKGWZILOOLJMIFHLZJWCQUQMSJ DCTMHNPZSDNITPOIRIFVPGJGNJVHRBEWUPMLUZPS AEOWTUNKPRTFMAVOHBXPPBABVUYFFZXXYQNLYKHK HVNFFJXBOFXEVVRAQPJSVLMGJLLRDCZWDONZXEMN IPDZMNIKZDPBKPCMIGJCAMQTBEOZAQYFKCOPJIFK LCQVLHUMVUSFXFLUHOGRNCFTSMNNPXLFLFYAGFSX XWTWLSFMCWUWEAWOBGNIOCDCXNGRUKGWUODZCSCO SRZLGKOUTQFAAWPQIIFTOBRIWMTXIXNXJPWPVNVP TTRNPXPMCIPGMWOASCSSDXXDHXAMSJCSTHXMYMRI FILGGQEAJLMGNBSBNRYMIGSISMHWAMIDMYBWKWLL VTJBDZNYNVZAVQHMZGNACODXPVJEOOQZAOKPBASM XLXDNSJKTCHVZXBXMHQDGAFMAFYXLVODQHOVHHES SRTCCSKTULUTLDBMDQQHECJOKODNENOCMDQWKFKG VHRVZYDXRCMVCNUCXCPRDCDRFJOMTPZHKIBPPLTX ZYRUSNNASLULCNRUDJMEZJKLRXXYUVNCWARHVDYE CEZQAKOXBYOYJQVVIVQYOGSKIKOAORDTGEOJOUUS ZWGCEYRJFKRTIXDBHOAFBZVGOAQBGDYWSXGTXPGV YYJOAEGGVPHXPTLWXIMAFBYEKYXBYTKNQRWYKFKW CJYGXMOSOWTHYKSTFYBWZRXWCLBNIKVKYJSVDWEX ZWZPBRHLEWPKZRPZPVJCXBIJUFFZWZWCXVAZXQNM RGXBGBBZXKLXJNFNFAGRJDFKQNIDAMLKDUATCENV CIEMSUDINOPDBVKPTDPCYTFSUIGYDSLAENCMVRMU MACSAKLIPSWDAGMTADACLDUDBFCBZTAPUODENURC WZVOCXXEOLNHROVCBDYOROBGBKVINFRKFKOBQMWO OHFWKDNMRVTTMGNYLAQILMSOMKKFZFKIZWFAKVTU JHRHETYHEKLCWMWFMNOZOFLUNARABDMOQPBBTUZG FJNVARKZZEJCLRQFMKFTAKEGVDJDLBXFUMZNTIHV NHWQXHPOUCCOLNJGLTFIRBHRFMSDLKBBXTBPPCYI PTYIPGEHRYUHYMXZBNYWTHPRFQFMKYSQJVBABYYG UCGHDNHALDGEUDMKRAJPWTWJNHDXTZWAZGQCSCMO VEWTPXRZLZKFVPUMGEZHXFITVRQPXPORDGYJPJTO NUCNOLXDVCSWOGYYBOVAOLZVBMNXZEVTMOTGKKTF BCYLTMHIOGBSJWONYPPDLDGTZPBTESMPPEKJJIWA VSLBBMJMBPCIYNACJGOXQDSRYMUDGSUGNMGDGARW QMAIRYRUEKQFQFXPXYIBFGPEEIRPDEWNHOGETHDM BERIFQYXRISTEMHIWGCYUFCCVNMEZRRTLAKAYNRR YGLLNCACZZBGFLNGCBGHWNEFZGTUKABOQTWASFGG YOWDKMSRGHYANWTBTMLPCMQTGXMHREDZLYFKFLTS LXUNCFWKDBDMBOKCLNKINRMQGYQQVUJTIGGIRWHP YOXHJKDZRZPILUMERQBRQWUWYIKJHMGIHALCCIWT WSFJRJSIWZVBETUPBOQENKFHPQDCDFWZAPAINFTZ HHNYSPMBFKRKJSUJIWZP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EZXGVFPLYQIQHAGFNOZXWVZNZKXEQZTCOXUZJADR FHQRSKZZJHCKCLJWQULATJJJCJFXGSYKCDVWDKST KYDYIJSOXHGKFJSEIMNJWHVHBDRPRDIOJOZWMCYA UHKHGMCJUKFMUMOSXNXBRDPHRSNXSTYHSEYCFLLU ZVTZNDZEOUUUQSUXXTEEWZQPZXKNXUOOKWCFIBGU NFLSWHTQAEQIGYAOPTYFDOXQPGLCSVLVMILEDXSE TYSKRGMQGKNBOTNLPWOQJLWSEUEVAAVXAAHPFVXJ ANUTECQJQYSOIEJVCVLHSKBZDUMRPZMIQMMIXLXP QJLLDXYOONJIGCBVXSDDVCPOGHDXRLGTPRDHOTYG RTGYHILDLMVPIJNGNTUUWWEAFXQWWSEKHYYLDQQJ VATOMCWDPSOEJALSTWTJZVTWSURQDXRXFLGEYUDK ZLCYYIKBCEZIDVKRLZIIPQTPGUEILPYLMLHPVLTC LHECXFWFRVZREZCWALGCLBAHFYBXZMEFITZJXHXC VSGNKQZZELLGWBZHDFDDVMBNHTTADUBZLNSESSCQ FJMBLNJROPSOLXMFPAQTRXJFRRUEUJNNCYKINVLU LUKULDHJNITZMBRBVNVTOXAIYBBQHFHVGGIWEEVA VTGPPSAPFMJYUHZGRPJTCFMWKKEMTGBHZNGWBHHH SKKHYHFJRGIKKACAHNNIKQCOKIIQCQGUCAXHTZQC JXDLSHFJUKFIVBOIJDOOWUQLZCSIHBWGAMLSDKPJ XQBTGBULSIMFNFCJNLBVVMTXCUUAZREJAHXMLJJN PUWOXCJIPBINWPVBTOFOCFBUXEWTXRHGPWLZCGYB OEGLNTAOMECTITECQWMILDFWXZXCDUDRZUFIJLJW UHGQTFSOIXIQBNRUQPAHJGTFEDSFDEGIYKLKMOAK NBZCVBYCGGAKYAEYVISRFHLOQEFEHSDADODSQKRU CFIXKTKDAZXLRNARVEFVTODJRSZOZQUZIMERQIRI CCPGPYIWPKUGAVESPEIVPUAOIWEKKGDGQTAQLIYX GDWVUFFFDLSSWYYYJKDAQNTOICXGHXTUZZQSQGKC OHLGHFZURWXDWPFCVJLZPXASBZRVFZWMBZQUYPPG AWFDTQHDWURJCEVDIROOWYHGJLNHGNWDRQKDNXFG CZMQDDFQVXQACYRKSBXMLOBPHBRIOAUFJIUFAGAU QSYLPTRZGKQIMGTTJCUWJQUNCOYSDNQXSCHBFMDV TMSFPGHVTDRYPBYWNAYEXRCOUBYYEDFAKYWEXHHI CIOMBELPPTUIBBGJGIOGIANVOSWRISWLNZXFXSAH HMXMTDMPFMZNPUKSSAIETLFEKFHNPYICVFMSAJLG NWJDDNLWXFQCXCHIDPNMHAYVAYVADVJZUVCJEHNP RMEUFOZULZYHYRTMSAVAVCIUMFXVUSLQWRTEDRGM VHXRKXYXZHRDNEPSMZVJDZMVFBHWZTDMANPBGWAV EOMUCIIRJFLWTJQNMKGEQVLHVJLHETIAKADWHHBP UPJREYYMRMETQSZDPSYYAGOMSFAGCHIADSAPSYJG DJPOCOBKQXLWVFAWWZMOOOHRHRZOGCLHLGGMHHME ZWBUIKIMIMXVVAUOMGDFSCADESMBDVQRJGJESYKZ RVINXAJYBUSKOSDKSEXFCMGPUTHYHRSRIXZLWRAE WGOJPYNTASMECFLSEJAVKBNEJRUWJNQYVEBOHYIB SEIQRMVWEBOYDTXDGMKMJMJSYPCTNIBXWKIOZXMS EKHSMEVOXUFZEXNLUEAJFVCEPEKEEZRTDYMBNMQX VBJQWCJJJKNSOMFAIFKIPWHAASSIIYGWQSXGGQYL VHNBEIJMDUCCBBPHEHWGKVFPCSKYYZONBREULHKM VLPDWDRNEYWHQQPAXCNE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      UVMDQUVWJXZDJMIANADLDIGTVAUHDMQARIQYYJNB KMVPRFHCBGGEOABZPSNLEXBYCONTCFHQQEEQVDNO BFFYIUSONBCQHZFHTYPMVTOXPPXWTVWHURIXBFGH EWNWRFKJQCEMQTCLQARDWJWAZJHXKSTOWIBLCZHQ YZKBIXMWLIOPEMGALKDUVPNCWOTIOMIHPLDFDGVJ QYOINAZJJEAESZJSOTALDXZERIYJHZMGUHSFSCPF TZCBYEBKUERBGUXSGGXIBXAUOPZOCGONXDLWDNVR QSBIYCKKRDHEDYXRYWTNXFYLINFKGDCYMOBOMEET EMADIOMUPJGAJOZRHBEHOHEABUSVRNFQKNQOINZO WBNSEEUHENRVPVZGPSUZCAKCMOKQJSYPNOMCOSYS OEXNSDUIFATHGHAZCFLHOSDMBQLVBBCMNNOAVPCR XQLZDXNDRTBOFAQFRSCBARCFBGNALKSRORAINBXW MUQHGUADEDFJOMCZHVORXGSSSXAHEHYDXBAWZSGF PZQDWNTAVUBEPJGJYLGRSYKTXICRGMNRQMGDJSVA OGCKMAAJEOBOUERXLMJLZXIDICLVTYUSXDMUIDFL LMYBLFDQDKBYIOWKNSFFMEHDXHZZXGEQMHBZVNCX MDPUDFNKSAVTTNMLOYTLRDLKTNKEABPUHQWZKEVO AYIQDBLCFLSOREBKCLZEVDPVPQJIFVCQVEBQQIDB JYQBLDPTGUEIZDDLJPMGSXDTSFLAAGDAUEXPNHKV YJYXSNIGRKVFRMYUMEXUUFKEEFLBLSWYYOCVGWYD IPLTTINLGYBAQLRSGZFGSLFBSBLFUIWUTMNIEMWD HDVHTSYRTXABAHOKFEKLQKIGERWRWFTCVROWXGFV LTAPZVQYTUMXZZCTOANIIZWAEZNEBAVFMTGEDKWL SIHJQDCDWJLVQKLCKUPDXNDRTRGPQCPGFZPTAGIO MDXMFPCTKSWYCTTZMQSSARNUBBRVJPXMUXKBRKQA NAWRAIHJVBVSXGAMOULQVSIXXQGAJGKTQSXQQMFF EBAYXVDBAFCEQCLGNVTMCGXTQBUKJEXUVDMARHFS PJNGGEOAAOJFWXOLVMRKABBFRVYSGDMCQVPBAAIW KHIVESLAXFLKMQQYYITJIWAVNMUJWVIDLHILNTQB YYSFAQVVZPEBMTXVWMAPQSEGJIWZAYZARLWMLBDP FQQFLKXKXIDUZPOIWRMCMZAAHFONUKARBNYNRQJL RRJDOKFKQWNYNPEFCFRSKHSXZERXACXKIOTNDBUT VZJMBJURDKUHUZNEXWJCXOZLIQSDDJSWGGLRUMTE EJPDYAFEDGGDAAHMNEUYZCBLIHABOLIBACNJHHEC EXENMHSRQJINYNWPXWDURGJVUIGYMRYKWIAWJSLM ZGZNGLYQKNMQPRCLAOLVCCUXAKTPEFQBXLFKHJYP SPLPLWLTMIJPWIAOGZZVULQNOHTLTBZDAXYOWQZB MLLOGWNUCUHXKXIKIFTWRWLTXFKKFMKOQZWMVRBS WEYHHETSHLKXDVJJWGOCYRYRWXIHWRDDSUNXVCFP TBRUWSQSEZGZKBVSWGSRZJETHIVYCQFQSKGQLIYQ LAHQWTYNSUIGYOLXXVLVSTBIBIRCLFOEOQRWPXEN KXOAJVQHXABBXQBKTHBXQIZUHEOEGRYGXRIHDULV UUPUKHABETWOBFVOWGKZMPYONDPNHJCGLQKCPKCH EWNHTZBKFUFJWTNZXBPIMFINIEJRQNBWGUIZWLGZ BVXDPTLVDWSKVBWHWDAMPTQTYPRFUJSZTIAHVLWW FKCPSITMSPDWFUQOJMXIELJQXXIIXQPUBMNHVHQY SAJRTRBIZWPQZPXXEWKOCTWCOVCTJDREWGHADWQI UFNAAIOHGXGAIRBFJZIH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GKLFEFUBHRCUWCRKZGDRGHRFBADVNDPQZADAFOZT TPBSAHDIIUDTGWRYQREKIEZSZEWOITQAXOJNHDEO VZUZRNBNIOXWRFSNODYCCPYIGHKKBVMTGCDNYYKI KSOZQVIHARBNAJOYCKUEPOJOIYHATHYKESXPWBQL NFREVXKZNEUMXEKRKBOKHACSXKTWAZZSHWQRZRUP GIZLRWAZYATRDBXUKBMFMMKSGYVEQWIIUTMHGRXV XYKCAKXFSXZYDCIJUAFIGMJLOPZALJJAGBGLUDTH QMWIJKVLHSSJUTBKPALTJHHZUCXHKAIIBOHMFTHG OQOLZJNCJMYNPEPIOGHKASPIFYPZOMQBXMXVJKDB NQNGFBSTHWEYPEZPKQQQSHOMUSZBRXGZWCGZPDAF UGDAJLSBJBVFSMTLFFPISIJFCODVXHFEQAMALCJG JDHRCLRDWJLIPSYOTJVSKNVBMDCICQQAQWZWGNFH BMUJRYNRLQNAOVHSOSQQQKGBDMXBQMLAXPGEKVCS VJVNUSASPQHDLFEDRFTRXVHRAIWBBMJBHOEXUZQY KYMBYCEUSPXWJTZIAZHDJSDSTVHAGTJRNONFCSMO KQDSYRVZDSJRPRZREKUXLLOXJWCSFZETGNCWZVHR FIOYQPEYQLANXWLCJNSIILRATNDGLAFPHZSYHYFV QEISKMXUDWAQLFWJRFTFUFFXXEJTCWGQFJWWURGG ZIEWLPGJXVXVFPCODLBZBENOEYBQLTICCMYSEMPE MLSHDAPHJMMPTPLOFCJXNVWZPAMWGQFZFBJLGCAO FNUJINKOOJEJRYCTJFLFAEAOKNVXKFHSTNDOFILV SZUNTMWJNHXFPWBPDWYVMYSEISKYWRPCEVWVZGMU KPZSXUNRPDAODFVQMSIUCMSTQVLLNBTXBNAQJNVJ JDJEBSNDGVAPXLGDEPBNTIJCRDSZSBTGWEWUDJQO PTMTODDTXKSZJPJLLBTXYQWHEWNGDKQFJYWVGBBS UNKAHCQPBNDQODNHMZMWPIYNFZTLXKOZAGGHIKND GWRWRXSZNPLTQMHNSKOCFJNWGDQMZROXYEMMHJPM GTAKEOQAQQRFBFTZDGRFRFOGJATTKZEIDCTEBTCV IUVDNTPURSKCAMTBFYFUMIEXIFDVXTLEBHALMSAD QIDSPNMFVJRUUIRZCPEXEIKASVTQRABNFVCRJCRO EUSNKISSSDFQJHGNDCQVTSKIHLSWURIMQONAQDZW YGOIFGZYYMOEBZPDCLOTJIXBVXFBATKMSBTRFSSE NLLKRRTZYSGUJHUTXNOSOKNQDZAOQYZYPRTKPYJF OTCZAOIKMHNRDTXQWBNYENLKDVHEIONAYBVVKKXW DVIXOYYNCOLQXIZFMNYVEDZJVELBPVZEZDLOLPTA CJZSMTJQODSIQLIHRACQYUFLOBUDWDYHANGZLHXH OTVAWAMOVAXNSNFZFSYTBAWJRWWCQNUOJMKBYVEW UPYRKXLJAQDRGKOJQONSOFYUHRUESXAKNLQGIIBL KCYYFYLSJKNPGEBHWKNVLHSOTFNXBCUGOFGGDVKS HBYYBEYHYBUEBFTEADCCAPOHTJMPWYAYCFTIKQSQ WZVXSIBBXOTAIROIJSZHTGSMUNBPGAUPKPLMBMUF TPPDOTDDYXSVOJWVKLQBOJAOBKLENGBVJSKYPTCW LGTSRMPAFVGACUSOFNPAVEGHCFKANPLRUBMXKADP VZOXZFNQWLTQLCZTBSDQNMZELEGCRBZLRQYGWJOF KJTVBFKEEYSVNYICKHARIDLFKXDMCVIRMZEPTGAO TUSDSOBOITRKPZFSCGYUNQXSAALSUAIKDWEGWRLZ EVDWBYBAWFXVTDQFVOCJPYMCYFMMGFQSZOWVFTIE BCKITVNBNWFPOHPHDHYH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MNTHMQAOSWTODMNRAZCDUJJGGTDNVSGVIJUJEJVR DGRTMVBDPBBQEMIVLJODQCVVWCCIUCVTYIGNOLYH WNFXZQZIOBTYXKEATUACMUIZDJVXVXKZSZLOQLQV KMXYWRCFVFMEUKGVLDYWJVBJAEZTPGDQNGLCYNNR ESAHXGRYIHWQXBWVHZMBKAZJCOQRQKVCTNUZBJEH KIOBYJKZBIMFRECJWUOQHHIDRWYFXRTMMOKCENAG RKNWDZYIGMMGXMWTPPRSMNNKFZCAAYFZTLNDYYKN KGPHKDOTFPEKGWCZNYDNYPAIWWWKXTNNVYOQTDOP AEPHDVLEEHLXXDBVWURJUOAFCSXSIGQRBETBJIVY ZPQGFUZQAIDPSWNBIQCCIQLFGNQBGBSOXNCVNAER RQCDILLRUBXQJVGUGFSSLSVUGMRLWOYQGLPAURQB PNYOLFOQCDQFVCMBTDDMHQQWJQQXCMJEOQNVBQDH OABJBIRYXFHRRRTYWFVXGXLPHOCKEQOYGCVXCAIG SQIDCNPWVCGHSACEQCOKPQFIHKHZSYSZAORENJZN SXADQMHPTOSWDFQZKRFLOSYHHEMUPRTZSAQFCZLB FBHILXEBLSSBZVXLNTKMMHHDSOYSVTOQUFUBGAOC QTQIASIMGXCRMKVEBSKDAWUMWGSOQNHADCFQNZLG WAQYSFKIDRHGMHEGYDVRDTXWUMPZPMOVDCYWNGXG KUKZIODQKZOQCZWBHGMKAKZDFBAOZRJJAGIIZZAC ZPTCUAGIOHUDEBZEPFZORRFPKRAFEZJMQEAZBOJU WVOKAGRCEZFCZOUYNUTKNFRYTHWEGAFBABRKAREM BTGZUMKIRKQJCTZTWCFWRYDOHMEWNSGMEFPSIIXK TJWCJRGBOANCWMSXYZUYTPLGHCJKNMVHOXJNYHCD UVUIZPQJXSOJJIYGSMDNANQBGRXRYEUOYWGCCUJZ NUSTIBFWRPLYPYUWXTBEGRBFPAINPPYXPVQNFRDQ LJWHLAYJLSQNQTJEJNOYIGWMBAXVIQHZLWZCYUYT MZSBFFZIZEGSKOYTXIFJOWPTSOSYCELCJMFEGVCE YYCXFENHYYTLZIJABCAOTJYRKJPHMTEVZECMSTIH ZUSKDQQQVODNUHELOBBCPIQEPVYISNTOWYQLBLBV RTQTUTIHFXOTHIFINQZCDLJABDHRXVPXYPGUJYBV LWYVAIZLXSUCGRISHRTNRNPGULHTSPKGPPLIJWWA IMMVZANGZPTIRKSNNKSSPKQXCGOTESKHAHVDHQGS UOXBYQKZOMVHIGAFGJNKFVBTZTQQSOJYWYERKNUS DYPPYNRNMDYUFDHSKVIZZAAPCEQTDMRIAHVZRHBG JPOJIKJFWTVGPZYZMWIXTWCDRZYYNAFKZVLIWLPW CHEHRWSZEGRNYKPEITJIJSPYQZISOUYKUUZJPEYZ ZHRRQRIBEPMZPEAPQZXKUWCFMSKHEPTFWDJZWULE VGSBVYHZXRJTPUKAMFMSWVXLKJNIJARDMJOMVMHL LZCIFZVFSGMIOPOCFFLSOKTWFXKNDFUMXVWESJXV SNMAWXWTTGIXUJUMTRFOMAWYTDEGBSEYEHDOTJPJ ZTFQCIHIYIOKFMDSWWBIUHPVGBYQAXPOFWTUXCOY RETMEIGLHCFSUBTXOCIPAFADOTYVSCFSOKUMHXSU WPHWEWKGTWNKTTJXNREGSLHTKQLGVXOVGHDOYCFF VGGSZVNZDCGADRQQALXGIYDQHXKMDTUXWECAZDBK SPYBACRWNAMQBYILZSYQCDWBINAMEWVXMBZXDCVF SGJYMMGHUCEKQJZPXDAFXXWBFNBCNAWNPASHVJLI EMEOOLVFGWTAJJPUENJCQTRGUALZYQHMVABSBWVP CVGNFOAIITSUZCYMCLZA
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QXMGCWOCTSZZKVUYJRLWSFIXGIREWAPUVUUHIEOS HTKUTAEYMUKWXULSZWXQPAZBECUGTJSKEPQEUIGQ DYYBUQPWOQKOIHOCQPMFMEYLHJGBPGETPHFAJWTT WVMCOABBBVQIJIBKWUEESKMFSEPYSKRURMBOOOHB GIUIELMBFDOCQXTSYMNLBUILZOBBRRHEDUDMUUAD QCJFZRQVSWWSIBVMEYISXAOTXYKORPHDDKSWEQGN NGIHHAZMVLEPIZDGZUHTZFOYEORTYUPSKUBAZQSW OARWKNJRLCZOSEGIWTFMLALHTKDDBGVECUYPLYCD JEGDELTHCFABYQKZVHSGXZZIDGMDVZYBYJTYXFCG KBSDFMANSODXUWQIUCCMCRUDVCJVCJWGYREXQHQC XOBFQXTSRUSXMTCTCUMXFNYSILMVFEMLZLTHFPTQ JLCBDFXBUIWDQUGADQFVNSAKPINIIMIYVRNHBSOR LATBICDWQHLMGYARQYBPEUQWAXUTGRVLVCLQJHJN BGISQBKHPKEUENPVRZQAWXEJCBOSOIHVJVYHSQIM NQFUXMVYRROIRAHWRHMWAZUSCOLYGSCOKETKGBER XOJSYJROWRCJVTHBCRGPOMIDUOTHWGGYQOJJSFLI ZXQVAGLDMCJLSYPRTBLWGTCRVFRAAGWCZXFVRMKS NSRQPLBOBKNZXOHJFELXHCJRWQJYZHKSCQCIBYRB YKLPOHZRMWTHFXJRWSZUNFBRSNLXNJOCLKUDXPRU EDWXSJJCSYZKRTBFYVVZKGFHDCEZIHVFQJQWJFYN SOEFROWYSEWESHUKIJQEQKGRFGMJDWNZUDAFSFSV WRYBHNDFSYFNIXEWRLMOVLVXRRDRYZBOGYZDJITC RIPJUNPYEKKUECHPBCKRCRQUWQFGOUZFCVWUWIMX LREAFAFVYNKDUUTHWPXPMTPGUIFHHMJEHKEYWAZU ASNMTIJUNGPOMFAWCIWHWPZDSGGXYJZUFTCOSRWT ECGRQNLXMKVLFNQBALSBKIYTKJTMDNQDDGZCTHRQ YTPNRXEHHRVIAUWBORXJNXIDXKOULXRWBQKJCCIQ ETZCALWSHAZEVWTHBZVOEBTOLKFXRLCFRIKSHDUT FZWCPBKEIFZXQIVAZPDHFGVQPWWMMIDWDTOSSCUA JNIFBEWIIYZTBFIFYQUGXHAWQXXOAXLUYJSVFGGM OVPZCBJPLPTQCGNMIXRFOFPTTSSZEDBJUNWVXHMX ELHWLZSLVIFMYLMPZDCCERIBHGDLVWJFIDZBNHOY RCILAXMOAHITTLUMWCVOMLPAOGIKLZGFWIAGUEXC BUDOTAGPGAFYRVJFIJPECENGAFPULLWAJJCRCWPL KHKVVGHJLCUZCHEAPJOLDNVJXCKUPNSTBLBPYURZ PONISCRKSWDWKJGMGXASVDQGKPJSNVDAZXYPUXQI ZBSSXQCFNRPGUAMSHLOXJSYZYAUYNKNJSPEEHHZR HSUDYSMPHKDTEZCWKDDULUTWOVBTDJPAPCKLPWVW TYBZMJCOWABEPGGRETSECCKFODCGYTHUUBEROJFF PELJBZEFHODVQVWCUUUYIUJACAQUCFTYXLRNLSWJ LIKQJVRRATEPSGVRYDPJNKZLTAZKYQKXVYRWGGPY MKCIAVWLBKVSCSRLFNURDUTFVVPFUDWKZNSACARE XWSLMFVBDHQHKOSUMETXZKFHGGRDAXZZKKDRYMGG IUGDNBFWXAKBAVMCEVZKTTGSEBKPKKWADLUQSYRE NODYYBFFQVSIRQYEANKDZTMLIOOQIRFSRCCUGIEV IQRNJBDFYWMEHATHLQXSSQPHNAUNBXMDLIIEDJPV YYPWSPFSQFGHMRPILYCUFBQKCFXROBBAJKJPCATD DVMPVEYWUNPGKZAHNVQX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MWREQFLAMWWPHSUCZNAVFTCOJNTCALDANLUVEPTG QZCECMODTZLOFMWDTGGQJPBAJZLELWTRXIOFIKTL BEOVTELGJWKQNSACQGZHNTXWHWETZJGWTBNMGAKK CCPUYDOIUIJUXIOWDTUFZAQZJATWJWKFGKRYHMZI OQMUEDXWYGKVMFCLVHBRAHPHDDNCVDPOGUCVKGWR BIRDMFSNUEFIZAYJPWEOYQVSWSLUZKXBZDVXWUKA SKFITXNWBOJVFALQKFNKWDMMZFOPKQKDAIEGGHBH AXGYXVQYYULCSUDAMPTLAICPOVFHASNIDAGGPBBF YPECRVRYFZBVJUDWSDCDWTRHGIGNBSATLEFOCQGU ZYURPEVUIISPZJOMHNNUZIAXQVCREBKWHLXIVSZH LXWOYPWHAXUVSLVOOJNQMZXGYNHQQHIBYFEDFXCM JNLSKAGLZVFMUJLQMICLOBHPSQQZNRYHTVXQWCPE OXQVJAQUUUAMEEYDQZTSGDZGDAICCKNPOQBZNOGU MJJZOIIPCUCKHLKVUWBLOUIELNEFEMUPNUYIDBZC FXAUDORWAECKRVHCQAJFKBDQTHQJTXHOHKRFCOHO AJUXZDCQJOFNXDASXSJDHZSRSTURLTEZHTDGXGIN VROUFALBVKCHGYKMFXQHGERVTPXWNTDHHMKHHABT DCWIRRWNSRPGNTVDBDIWZNHQXQFRABIEOLMLEZGH HZWOQZTGIJYRSXWDVDPPFEMWYCODOOHVFDRHKTYN QAXEVNJXUNMKAMOGSTRMSWDPKJSRBWQPIPYCLSHJ UWYWNSMTFTVDIQAXLLJEXLAEJKPACFQQYEZQGMZZ FRSOAOQTGFJINPNQTNZMWJKWUTFUACSTCFJYLFWX CMDVRKWFMCPODZDOTXDCMTFQOFNLEQKPWAZSWNLV ZBGWDHTZFLGAJATJWLYGNAKSNJEZYFFLMCVTKXQW ZPDMZSNXAWIAZCYCHZQUKNDFCTXFXRWKYTMDABFK FERXVRLVIVICROIVVHIGMVGVBBFEIJWIUFLYLADS PSPQGTOIPNXCLTCZWNPEIKBZUTLLZSGZYNCMQBAB HWEWWHAKZEPQLGDJEWKOVDMKKJLPOHXXZRSUWQAC GXTKZEXCLSFSLINXRBNWNKNAZYWHYVSEDDDBNGYN MBHJGNWGKKHBFJXXACLLTMUPBNOOQGAAVHOAEVTU JNDLHHQOVFUFFBHNMYZDOEUGVPQOLCNXGBGTLIEI ZNUQVYMJACLQNQYAPFTXIRYGREPPWZYWPKMYWRSH MBPABSCNKCZIEUWBKIIQFEQFOGVBRYGBISFXQJGG THQKICJLRZWCHGUEGFRWWUPDKRXSUDQQCLKXEJEO CHOTKDKRCEUMEKRVMBQCESBNXIEGYGPYIOVOIIPJ SRRWZCJNMSPIMETCLDUJYUEWUAAJAHSETIHRLOOW BQFKVFENPNPPJVGTOREXXMCNPADUQXPRZJEMKQUZ QYVEERNOKFLMCLPQWLXRKNSDYZAMWTAAQFZVZOHV CUUXNSHHLXIEXAIRRRVECMFMPQFSEOODUJTKQKLK CCLZUGJBKOUHYSNIHGPNQAQLIAUEGFLMOZHWVGDU QUJYTXBLUNEFGMEXNYDAJBDVEXTHJYAYGTPMTMNB ALNBBIZUYKPALEUXFCOZOMDEJJZNPSPZSJWNUKYB SHHQQHHDEYWPRXSVSSWJCCHCHPYHAUCPDVNCTNCL XRCKZQEJXNIQLXATAVYKVTMCMFXUDFDDUSGGQQWF INPNBWVXAPHMDNTXHRNHTQQAQVITYTBGULBJEDXJ ZFHMNRILBCBUUQJNEJMGEIVWGAGQNCUPLTOCXNVR MZIOOBIBXSOTHUCHQXZHDVIITPSWAEXUHRGBHFZW TSJEEGBWKFFIWJZNDMXS
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PEOGNLEECRBBZVHFGENXEWWYAZCGPAZGJYRYGRKZ IDRBVFSDTMEZXDSASTMQSRMOMCVKSBJXLMMMMCUF GYZVQFGWVQWIDMQLAOMGVILQLZPHFCIUSWBZTUYA ORDGWPWWULKSZOCAQNZQZDVPNVGEYWLFZARWHOLZ CILNPPFRWVQEWUFEMSUJZVQIQVHFSTFJTOMHULBM CAFGKRHMMXHWOZKGIISDIIZYHFRFSHXSRWEARSCP KQPNPNNVZMHHMENOZEWSGHBIAGZTKFHSUYOPXUXO LCBPTHHWUWBBDJSNLXGSRQAVKEXPQNGNJBLGIWRQ HHZXIZEKRXBGLGAMVKRCSWLVBYHTHNTDWXPDJVBP GQMNXXSHIYFYRIBQMPBXHDMCZZPHCRWWJKYQOUOQ VRQMGILDNQHSUIUDETXPXENEVGYXKNAVBAGVOQUG ESYKNQZKQJYTPWWGWLZRNWPRQKSISVCCBKLDXPNU EILINJKMQFWLRMWSVZOTMAJQJIBOGPSXTIFCDLBN NPYFBUYXCYBMPFSHATBIZANSDJJRFTDICTTIGLXJ GOYIXFZVIYIWLBUPAANRRMMAFHYPEFXSRHVQFEQG OOKCGCDKQKBMQRSUVOXXKUWKDWVAFZTWFNNDIVLS HRSTFCTQLXHCEANWXLEAXTHISTGMMTAXXYHUPGHE PYCYKXBLIKBAQYDKKBOVZQNGJWCTXZZJSJBCORJD MWFZWQXCIIBLDWZBCUIIZICPXZIJSJGCIIOWPNZO BMKRTAEKSYCYXMCHGDHSCALJDFIEJDBSQUVEFQMU KREILYYYAGXDWGXNSCUVWULKAYOMHPNGIVPWDRLQ QLTLLVGHJMKQWUCXEOXHTVTXHHWJACYSMKKPSGZV TLTIKCOGDNOSTYCPBQBTCHAZULPJVNCVYJFFBBYJ KULEDYOVWBJCCSJDBPRDHYJFGQXIKZHPAHCSJMLI TOSSHCOPPVQHNSYPZZVQVGLQMGHBPNVXRMGZTFOV ZJQKPHIWMVLDWKURHOSBGXYMGSERRYTZOXBKOXML TIPNWNDLOXWBORNKYCIEQFITPOAMWKQJQEXFTCTU VJWHYIWTIKCUWBACAMWEDUWZAOLJDPBGTAEDUWHL NZEXYRWCEAFYBOPKQKKNZZALAVOSCRTODHLULQKE OASDWGMNMHWHRFOJOWBHXSWPVIDSYUWXFIOECQDH GJTOXIMTSANKCTQYMLCAVXSCNFIBRFHUEVDKRGUN MOFPRIZQJAFUQFJPDVOWXLRQJMKADRRQTXPTDKZK NEHLCQPNSQAHSXBEGHXZFSBPIIIOYPMNEHTHWZHA SHRXVRYKDTQCGHODCHSFTSRWEECAIEXLODLVONTG LFUMLOPNQORHEVFRSHYCNFUNWIHPRONXWLDMDQAC MWUTTDLHIPPJFCYDTDJMLUCQUJKFTKRGZFMLNNPL ZCJHKDJSJWKZQDZDSVYOGECHYHXIWBOLPYQHGIJU SBLRWVGBQJVHUTJNPWEWAKWITZDXJQCXUFRSUWKS MHQNWKTDPGHDTITHFPMWKGSUNOUGMRWDDFOKKFWK LMSMEEIVYJLWHYERTSGNIXWOEYTVLXLOYKRHCZDH BQWUSUSJFBPWJWEJQFFHZSQXMHJSQJOEKHUHYKJI ITJQKVUIEBHLCFVJKIARKCUKTPBJGYUUWPIHRSSI QINQCGMAISIUVTWKGBTBJMUNHFQXAKNJUGLQRXDX TVTYCJDTDNQDGPXCQGMXTLDLIUXBEYCLMAWPRJYU NCTFYLOZUTWLIXXYYJPVTWWJMAGCLDETOAFANVPP RNZKDDCOYIYPXBAJWTFZJZUDWMSVNEJEYUXRJFMA ANUBSAECJHBDGHCPUQSIZCKYGUIKSCTHJMMSUNUZ VPJPZSFYDINUXWVXDUOH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YOFQDDDZUUYEMJZHKBOEMIDHNNNDOKCYBWEVGLLH NMGUSICWZCIKITVOVYBVBPCHOIGMEFQGVZKJTTIP HSZXOLETAWLWZAEJMHGICEKNGAZRUGTRYSIGYXXB HMEWLXFIOUWJXGQNLVDISQCNAOBLGUSPWBCTMIBQ AXRLZHWNLQFWIOOMYHOWPGCYOSWLHBZXLQLHUIJE AIEVXSQFYOKGPNOYHSWMTFRNSHDOLLAWNIBNIHRF DUXTXZOLBOPOBNOWBTOAJQVWYTYNIHYJTBGLTUDI BNDYKECAMPKBWISVNRRSUCOOLNKOGZQIHKMUVDPI ANQWBJRAYJNFMWNNDSEVLEQCGOQMHFZUUBVNMYDL YAZOPGJKMDLXAAIPKBQFDYAULAJIQKBBAFOBACAS EGWLFFITCWJAKFFFLGXZMTIRVHFFBJRPSFPQNMHO OFVKUESMVTOMRGYRITRVVOHHOCAQJCCXVYIORNHJ HOSJLXJPSJWXMNIWODEODRKXDSQKOCVNYNGNYEXC PRZVOSGOFQBORLPHJCWKKFFRDDRVXNMXQKDBWHND ZRPOYCXRYCJTADAANBJHSJOKGWCJMHBBRJAGHMXK RKHGXNUPSJIZTOTMXFPNWKOZKZPMQDJVCMCJJEXP EHPEVNBEXBOTETLTNSYYSCCRAUODDHIGGSFUWBGA QVUQIQNHPDIIYPERWZBXAPDKZICTOGVGELWBQNAR LZBZVPCITMJHEHZOZGZKXWREGVTXDZJRROROSDGY ZIJGEDMWQBTEXWYJIHZOZDYLPSYRQZIVAKCMJEIU LZUXYCWNEOSVIPUGSUYXLCAPYSHEMADLQSBKDTDH VHNEAOZQARNLUCPWUHOSVDNINVJIRJEKKYGLWUPA EMUTFQMWKHSQQEYFXYCXCCBRVARDSCPYVBQYBVXT XYIZSVLGSOJIPHJSNQALBQBRXBKKNDITZDSMTTPY HHZRCVRNWXAAKQVZPAQILOSSUUCUCCXCGLHADKNQ ZVIGASDRHSAFQESHGGGFYDWVQGUMTBQOZXQDETLC HEUBTMUSARUNNIEYEYHGMNZOTDRXFYMFNPJHKSFO FBGXNGDOFATVOYBHELQKZZSFTADUSZTPTWPJNKRG OVZAZDODNDMIRZENNBMDMDCBTAXQTNXGNZQQOJJR CBITKFMCHJTKRHZSEMOWNEKLULSXMRNYSZNIVZGE USJEWTQHLNLZMSPCBTKYGGDPARNLSHDLXDSGLLZE TWLFNLQDZINTEYEADJOEPCIUNOYIPSHVSMYPZQFV TRYZXRANSQSRXMEZNWHJLAUPJRNTGUGKDMWWLDGU OWXMRWBJHFYESAOVXGELPDYTFVFJFVDJXXCRMNTI OANCAPRXUWSOAGPXUNVSIAQKDELSNSVCEXJHZBXK NOROIRYRYRQKRWMAACKBEMOKZHOWSFZFDIEMFNPW ALIJFSCUTXKTAEHTJHAGRWOLWGJYYVRKWDPAUSGY HHGPUTERJUQIFPNRDFXTDKWCIETNNFDBSPZGFUTU XWZRELBGPFZUOCUTRBSMFBAAIHGQTGOTLNNQJFET LGCLJNUITJWLRRCFQMEQMBSACJHQLEUZOVTTVZXZ TKRFIWGUHYOKLVJOONIXQQBUDAMQJJCHJFMDXMCW KYJGRLCFMMDULGRMLPNEYTCYTUDHVJMOJNIMOXIO STRVQJRRVDMPPLYWXYZFJFCIVSDSLVMLACBBMHEB DYDFKKTAHJCGYWPXLFVJWKVDMRQWETIDOTIDSPCL MRFTMGWFOCKSXXWHBMMVHVPKXSWEMUKNYSEBOJCX ZFERZIFVFBXIVIJBBFLFRYWQEKHNLKPYKESJNPOF MLBYCGPGRDGRLXEDLDTNSEAENIURXZSXLAWGUNCL APFWDMMFTXLEMNCXCZTH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LAPYMSJMPBLXMLJDGNGKQUFLXGJJVMAXPOLZDVOP MRXRGTODZPKZBMLVEJBAMHJOZUNGDTZQECMYKCZG YWHIIQVGYSVFBSYGQKEWVNAMKFPXWCLYWLXNGAUA JWVQDTVQHTTOJJKSACDZJXXSCXGMBDNHQPIWXUQJ HWCORXHRQIFYLVIPZKUGVFNPRYQIGFYCGGXMQBFE AQNSWZHJHRMHWGDAHLEOXFYCCOYZMZWBHJTOAUBC INHXAGQGDCURZXRYKMDMWJIPOJCYIKCOJNJYCGST VOMSXNKZIMJYVLNJEAVSCNLMGWDGCGBBQTHIKXVF ACFBGBDYIFPSOYILIOZKEZNVEGEVUEWXOWTQCNOJ SBOUAQNIYJQCNDTOMKVOBMFECVLHEYBVXCSTKLOD IKFUSWZDBTRMFTUJVQRGKBUOJXZBCUXXACYVRREV GIDTLKVIWFWUSWAJREUCINWPNDMOJSMXKXPJHZXA TWYHIVPLXFMSBMAQNUDBALOYLRQQKNJXAFPERBWY QJPTQPOLYZYTYWAOWMOQKZTRECLASELZACQUMLTL RHRWMHGFGPKYOETNWZOCHIJNZFGEHVGNIKIBHRRW SWTCPWVUMYGJJIDKVJCXRJWQEILDTFTPTKSOTSOV FHNWRIZERKKXQNOKRTDOPGEEIYBFCTKFVVSMLTVA DDGUJQIVXFYYLLHGHVVCQNIQBBESVZDSPJOCUAGF XBNVDVDWUMHMURCWCUFIECZLGEHKYEFQFOESNXHI GATRVSIFDETJSPJFYESPVDYVOKDKIVBRFAOGDQAP ZFNJILJKERZONUASNEOSEIZOIZLOSHJZLWPAPQVS LAIQQQILNAPTEHOWSDBRPKTWIPKPABIVKOOPIUZR BSHFBXGGZWMPDBKUGBZBMTKLPVDRSJMKENGWZXBS OBUOZEZZOSQDBXOGBVRNFXLFXHPHAUQYPWSTFVMQ MTHCBJVWFMXEMFQPAAXCOEUYXPZABBIIIKCDWEUN BTNUHBTGWNTATTKDYSZSKZOPUCDDVYPCLKBNCRKD CHOAYHTKTJPNRSHWFRLQYPWYEHHDNQCQSTPFSAPA CTSFLBBZPZTYEJLICQTQQWBAQXGJMYSVWKEQIZMH UVCIFALIUZMEVZKYEBMKOLDVTVHQKAKMMGWTLQPR JRDYEPQKCPEYFTURGPUVHWBYAMRHCIAOWFHVZWUP HKIHDMKJCUXCQRQVXUWALDVLLWBYGRQUDJAGCVAH UHGGIIWZSXWZKKROGPXGZLXMHIWQAAPFZJFLXCDV MGJDDAMVRNHANTUGEMXSMQGSTYAWUVAVCMKUVLLT DAUMCBUWPUMKMSRBDEFGOZUKFXJOHOPJHXOYJDPM IKOKPOBGWVSXMILYFQANDAWMRSGVOZXUIMFZWCBJ ZCXVQOUZWVBSSXFKIVXQFKELDIJVVADBHEUBWEGR QACZEPQOCUSNPJRQIVQRAEXXNADIVCYHDNVZCTNW GLFUKMIMFKPFRGPHEKLMTPZSTPWKLFFMLQHHRYVB CELQGHDQKSXQVRDEKMKLWWUURHKNGPEEWQGZSXFY VAWTMLJIZTBUZPEFKIEFLRMJEXOCWTEXVOEBCDYL JFHAOPMTUZXZREEVIPJWGSKIEPQIKXIQZIZZBTCL IADZEBKNEIQPFSPAVPASALAHVJHUSPSEAHIIBIKY PYVVWJWESGEVLQXNSJOAQCXEOCPWMNGOKHYFLNYD VDKNMXEWBQQVRMLDEGPXDLZWMTCSORIICZHIUNDO MMZDTODAAKPDWHRUCJZMSKTNFWRIUFJBWDLUEDKT LXCLEFBHENWSRJXQCFEQQNNYUFDIQHDYBPOUBIBR FLCJRALGFABWJJEMEFMHSRGQNHCORVFKSYKHAXJI NBVWDJTYEFEJXUSPOIYZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      XYKISRYKVIESTBUHLPDQIRXCCBFCBBZNPSHBSFVI GYVUGZYFRQAQRZLYOKKTOKQYWGDGVPWWYQXRQIRU HVXPXUNINEPJCMUHZBLMNKDGEOXUJQBVHLFKWUDZ OFTNTZIKPAKICZTCTYFORVWURRZDFTHOMZTQTXME AZCWMETRWYRQXAAUQIEXMLTSGQQWTCSADQTSXBSM EUUJZBMKXCTVCOWVWPBFOYACXYXANBHMPUGQXVWS DRQHBYNKNHKCZUZDKOEDCMNWLEMIJISXQWGOGXGW NCDJYJUSYOHZYFUXBDRRCZOJLUQIKAPMEDNAGTCP IHFGSLCOBYZHMHNTLSLSTWECTJGADSCZINWSYMZR PBWHVICYZMWDBMFGJAPYTNLVJQDURAZFEMHFNWSB HUOILAGBFSHDWDTKRUZFFJIRKOJEHJMGVRJKZRUY LXMXVLWSXQSPLNOKGYQRXJOEOROQXLLXTYJZFKBS WYFJYPZLPBVPFHEBFRTDPOYIHAUVMGSJGXKPWMGE IFSVPJUNHDWQMHYOMZOIKUBLRQSPAUVDATZJGELK HKYQRTHXZCAKKBLZGDHVVZUYUSKRFJUOYZQFYABH ENAVFRVJIYQIRIUTAIOHJZUZSEEOCJZPVFUOOXBA DRZOVASPXSJMNUQZATPUETYQJZAUIHIQDUVMAOUL NBGJNTLTUVJVJGQGBLFRBSTXJLHTDPDBCXDJKVXS GVUNVEKKMWOVYRCKHNNFEDLIGWICFVENTSJBJXYU PZJCRDFEPAEYNJRRXCDFKLWUIIFMGSVMBYGJEYSS ZXOHUPBZGGPFZCKJIGVZKHJXXKTPQEHYAQAQUIKB CEGHNGPNZDQYUJETPJVFMDOVEVPUPANFPKONMUMO XCBJDMUYKVKBLYGOHYWYFBQXBWTUFUPUXDJUBHNZ MQUTKEPOEHOAFGXVVFZKVSSOLENSCYFDXHVAAYJV HRTRBSGTKYQCEGXSUVQQQLANJAISPASHFVWKEEBZ KDZNYMESEXBLSEJVFPCBRTADKRQVUPWQUHWCJHAK QBFLMJWCVFYVPRDYHUWGISJFTQKRJXLULOWMRCTJ KCGSPLDFVMTGHQIZXWMXNBLMRMVQFXYNDKDQPAYX FXEEXHQJRQOBYTJROLEMEETBNVWYGGKKKLSIUNES LBRKUERCUNWYEZIXAQYBLJFVNOKFCLSLGFDRINPQ NHUITFANIDHXFUGRBDMRMDSAMZTHIYGGDXXGGNWU DYUVRHIYRIISNZSNHJWBKSUDXZWCGKJYGEDQSXGE PSOKUHNATHSORMVOJJUSFWXVQMTPAGVBNVIVNAGN YRTNEURWQOTYRMYXSUXBMWHMWDLBWZMMPQYNCRDR RUFALQDMOEYQVNSVHBEGYMXHLYGMSJHRTLTANXLU OJZWDEDOBYUEVUJKAKKIPRHWSZHFKSYQYJUNODVU WUBVCRKHPQMVNYEAHROKPPSEPQHVMSFBXOBKSNHH VXAHCDXAVQTRZBWYZJXRGPIKPUZVUMAXPJDEYZHG ZCMWXTDUHBUGVULXLPTDNAMCUNCGNSAOWWYIFUOP ZALAXHGQXPIHXBXZAZUGSPYOZXEEZQXXEWOFQLWC YDOZIUFDDUYFZYZPVKHPYQMLPEIMNVCXCWVFRFAN YYUCOYABPTEJMRDCNEFFSWXJSVDYYEFLECLXOURT UEQQWJYXNCHSTNUJCXLXSUYEKHUWKGDHNJWDZPLE JHWIMOMVZMDOADFPWLXXIRWABMQQBQQRMDXQDEJO FVCFRZEJTYGVORGPUCGHAHOFQVMNDXOPPWSUVRIN WMPCOQLSYWYBOSDSQLCMPQRHNJCCYHGMAKUHHEGO FVBEQGHTNWUQGJENAKKMZTLVIXJJMMSIRLMIPZIV CZJWHJMVRKQLKZMVJBVM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YQNKNOYCZLRZESPYNQGBBMAUQLOWIHUFYGZHLCIS NADBRQTIEMCOQGBDCTXBHSBMIDTFWJWNDZGHLMYD IOJDOPNSSOKKIENVWCEGLAIXTAOPLKICJYGAGRCB QVKVYBVBHRZXNHXYMYPHZMSXTAUCKBHFKTPRBOBV IYZYHDJADYXGLVSKMHFLYELBFMFRSPWVVKVIECSI ELFEPHHTCSEWXAVWWQXPDYDUVFNWVPURXCHOCACD XADWNAUNXSFXRODJLRYSQLVNBTYWFDWEUEGEXXAH UYFJMWJJIFWSNFEWCCLHNDYAEOGVFJNRTUOFFLDP EOOGOMXPYCHCUCPOAEVNWZPRZMTTRJNJCSAHJOYG LMMHMEQROMDCRKJQFUIVRUVEMVZKHVBUUZZKFTGK YGRBVKOZCQVJRRFLWXCTZCUQPOKZVHTAUMCJFITR WQYGBYPGKIWJELBNFUMFEGWCOGQBADYAKDFKWOYO XGYDHRQKZLTDVDWYARHEROWWSTUJLEFNAHCLGTVR ONUYCUPOWOQCEJADIYQFWZGZWBMSZRRFADECKZCR RKWLZPZYOOTSSACBJNRZNCLSTBWGOCTUBODCEIHQ BXFZAJTSGKASGHKAHFKUYXOVIBRSDVNLNUORPVMW NWIIGEPTHBXJUNIPNYFRHCYJWOJYOJWAUSZFRCVX FFVBHDSUHDQXGOIQNAFQIEJLGNRTDDAZPLEPFRUI PGACABBXHFABUAFVFIOWAXCLHUCCKFFDUUDCPAZY ESTMFUTTDPWHWKTMNDCBJCYBDMMMTABKYFPZKDNM WTPURXULKWQFIOWSCSTVKZCNWGRZZXUHWDOEXVTX KCBXIIAMOIHUYUAGDIUTXBHVTAOXDGUICKTVBIWZ XLXXTDFWQPVUOJDCZLHQFZUUIVVCVNVZRNANVWAN KHHTQEMRORDZQGBKEXYJIVCPLJMHMHCDNPRAWLOL IAJLJLBFRSXLHORZJVRLQXKEQZWUCBSCCNXMKOIZ JVMIDZTTIXLSEFIQVJMVJLTWEVZGIYAWJQFQNCNZ MDEWRTNPJSOTMZWNYOJXKROWGLZJDTEKXTYBVTYQ URFOQWFYKWZELAQSQZQDYDHZQIDWALIDGOYOVLSE VMIVVOAPTMLOERBERZPIGZTUQRHPSXKZZFGXEBZW NBSSZCEIJYGXSBJGGUUYQXHQALRQWEWYMGNLLEYM TJHWZWHJJOKFTADTIFXMMOAUGTOKOQDDCDCJXVUW DHUNACIXBHFRUPZSPTNNSDYHOMOAOJTCHYGHGXMR JJDVKYVEVGHFPNGJYZXTSSCALQUBMFULAKXOFQRS WVCAAIJWXTPKRNNHFXRAGGBYRBJZSWOYEEJVALVN FZWPHVJNPNSISYDQHRJAYFPZQWOCSDPOURVQXRRG GNHGHRNGLPGNMBTMJVEMXSGROUWLNRWDVGFTJZTN SLQTOQSIXBRSIOJVRRHGUFOEQVKQIRRNLLQHDNIX XJCNBLLSWOYKUZVKFDWVSRGRCWUINLWBNQUOHBEB BUGQSBCQFOQAXTKDAAQKLEMRQMLCZCCHTBWVJMYD EJGQZDZHJOQLQDXPQEXPNNBRCDMTZOKEGEBYSYQY LDAYBYJNVMUZZMCQXVJTKUYQFFKEIFQUUBQXIDLC JVHZVHQKRYJJXYFUGOFYTUTFIFBAHYBVPCQYMXFI ACAXWOPEAMIMBPHIWIJJGJECSERYDYSZWKSLNVFY GNKGIISIAEUJBHSDMUOZAEDRBPVSGCROYKIUHTTY DAAGWJCHYVIQMVZTESKIAUXMCOGXEONNIVOXVAOB MRMFRYBUROECURSZOLMMQDOCWBYMZIMOHWOBMYYT OICQSMEFLPGKCRAEGSJMTREDBOMMLMENYFLXVZEK GFJYBYVEARNRDHZEEVBZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OAMSIHHSEBAXFQXJICAKBBPYAAPIECICZRCLFLWO LNCHSZVSTWVXRAZLNJFEJXROQSGGFKHDBPKMOUWO LJCEKSAGNQKKACIPIJQIKUTDMEVTKYYPWNTUMNNC MRBJOXJBYFZAVZEMUZZVVOMVPAYGDUWMAVABUQDJ SKDLICCALRXYOYVWTJYBIWGTYLTUKUKIVHSFFLMU ELVKWOGMSJBZSEMWTAUQFBQBUSICNQZHWQQYTNNQ VIGFOTTIPSFKTOJBJZOSVRZIPFLFIPBZMYLSMBYA EUSZQZMVBFQUGGSVZWMNPEEKXNLVPXUQXLHGLGNL JFLSAAOZJYKPMZZRXOQFEYXLLJOSBWHWPSUTWZWG UPHNEWOHSKQLQJYUBTRSQRVQALQBRADGMCAXRBSU LZNSRLZYIDAMYXHTLHAIDCDKBEPDSSBWHEZWYOZJ XDNMXFWPANTFHDGZRLLTOCOQABPKMPJMWGOWQJPX YRNLNPXEMKLEMSVVQIOPAEHGPUQUNHCMTVLSHYBV YCURDMXNOCHRLLAWMKHZOMGYUBPPRRBXSPZQLTNQ JAXXTLKCUANHLDOSTKLYZIDKUWGQMENUXBIQNGWI ROORMTUUFZDFCDVFYFEGZTEQGFLHARQHCMQKJLRP NDXAPXPUXXNLZASEBYTZFDIVNCYTQPYIAEHFZFYQ FSNGSGWLMZBHJYTJAZMUPXJVHULRXUGCNQONIMUU FOMXJRXSSVSPZZAAKVZAWMLHODWKRKQUZTCUURUB WHHDDJJOQALRMFIDDWJAINIWJYSXKMEGHQUMTRUO VENSIQNFWFUFTCPIKLZSJINVCLHWUIQGBXAKABUN QCUOKOJFIDHYYPYITKOYFVEKIWZWMPGLGIOKVBAT SEBLFIRJXHEGTSCGRATVRPJTQIJFFHJVUKHUOFTF DJFKVRBLJWXVUBVATMWGJZWLIRTSIEDQGSWSOJZQ QZZCEMWQVWIUZAPAAWJZLVWENNUAMGCTMGSMCTAF BBHXOODMADAESZVDKJRDNFKIHOSOIASSZECMKYZH ARWYCQRGDRGXUZLUSBMKAAZDGBNEMYQJDDJWKASS JVSYNLSLCGFTVMEQNAIVGHWLDZHJHZRKDWYNIUGW NCYJGTDPYTUWXTBVBKYGOWDFRCZJVHZGOGIQAVNN ICWIXWYRCZVRIYACFGMVQIRSEPBHPIHWLTJOOXYE QYTDGMIFCUIQMWDSPEJDQMZNSIWJGKSIHFSNNLQC DZUVCYOQCDCNIULIIRDFQTVMFOLYSAFUKPLJNKRT MFEADKMMCOHPHZIRYTVESUTPHHIURQQTIEPETLCS VXTSKGUZXEQSXXMEGCGALTAPLCXLRQCKLDRSJOMY WBHDLPJPKXXDTBNHCPSDYJICBNOLEZBMPOAFBUOD DVKHZDRLUWOYUTDZHPZWKWVNCRGEJJXTBVFNXRZA OCSWHJCKQBCAVDVLDUOXIDFYITZNEWRBMVOGBWDT KZCEDMFBGYHVHVNVSLDAIFLMAFAAFYSALCRLLIQQ ISEETYCGDICJNCKXSWKSYMHIXDVDDBEEDKSGHDMX MOZGTRVKGGUDHDNCLKJWUHYPNUNTZSLADYVMBRIV FCIIUAZVVVIIBAZKIFHYOTIHAPPOPUAJBFQUXBJZ BGHWMCSJUKRPGKDRYCYKBCAEAJAZBSOKFIGMPWLD JDIOZVPDVUGAYUNREYDCJFKIDHIQTYRVFLAEBCKO TGRJZMWCUZBASFPGWJUHDOOTZQYYSHIPLSIJDFAP WOZTAHSIDOZYLVTTGKHJVDGOMOQDAAHLFRBZVOZP NJXREDVLBJGECCRLRSWQPHOQYMEGVCTKPQAUUHKT HKOTRKXIHKVHTZLCGMINSZORHWZDKMGNOBMLTTQS HNOVAUHEMGVCKITJGDOB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SVCCTQMZHQTCBXCXOLBUUNQFCHAUZUXXQERYYFHQ KFZIYWZYUIWZEXLJVSVXVHGEAMTSOBXQLAOCCYRK ANKSSQRETLBLMSVFAAOUIYLKYAFTEQUJXHEJXSYQ KACOUXWVEXWBSMYBGYTGFVCFOMMILQLPSHNWVBWQ MBHPTLFPPIYBRAAQVJKEYWUVZRNZBGKRWTOHDZCC CJRWNTSXRFRVGOOQKNESVRHNTFMEMJAQFZQUFEOH FBSLJFSUUBMOACYKDGBLSRQEPGIZEYETDHHOCMNU CAYJVPNIIPBHRFVZVAWSHGECGZWUELORBDVWELXO SWGUUMWIANQEJXGNNXQVWPGADBBSXURTBLDJXNUZ WXLGVZJJFNUSYEKNNFALRGEVEEDYEXXGXFPFHZQA QDPSUUFDMFMXDDJAVOLTBDUNNKPXTEAORIMTXXLA FWEXMRFWQLPDYVJOWJMSFJGIKWTTSNACOYBYOAFU FWRDCQPNBTQYQBTMPQQNGUVNMNTLRZKUKSSSABOB RDQYOCTPQJGCNQXXFBPMNMWYPBHWLUNKDDXXPUUZ TMTWSYHHDAPCVBKMQXVXDPSOXVDGGUFOREGIKSBW MUFMVCZFFVMOFNUFZCPLWIZMJMUYBZEIUTVGAHEY MAXVCIUITQIFHYGQUJKJDAEATRGCEVJPEXCTOKJH SIEDPFFGGGYFFLGZDXZFDNWPGNIOVRKISKGTWLIS ETVQBZJZXBSILQZVDBDWQAGORLTEXPMYTHNWHJFQ AHSCZHDXGEKMNJEIKCVLXHPDOLIBPBRYQNRDHDKC BIUCHWWPYXRGPFDQNPKYDNUEULNKMBZDTMNSCDNB CEPZGQEXGRCQUUPIYKLACDRCOJTHWIXJRTGDZBVO PCKKVAVIKTRDWREICFIFCRMETBTCFRXFFKLTGYBQ DKOXNVHFDFIIQSDGBDZFKTDXXAFBIRWBBDNGLIOG GLSMBSXSQQLCFEXFRCOQCMKEMIFFXVVDTNWDYCFV FIFZRUACLSGRKNOHQMQGBPAHPDJCKQVVMCVZHADK URIHHEZFGDEJGQJTZXEQLMHCUUKEVYGVFGOCGANC ADRNMHWXNSJTLXGKBQRANDITDKRGQMENVCNJHPXW JGCESASUPJNZBMGGFMKWQQOVFFRWMRAPKDXOTGMV HFNUMSVIZXJNPMQYVURISSVGGCFIEATWGILZHIUX HBXJMSCEOSRYQVXPVDWSPLGSYPWTSFHCBZWOJAAA YOWKQQEZPFRJOJYYRDPBRDYCQMTVRZXUATGALSAC XQUBYFHDZSQGWKQAHRTGUQPHFNIDBGYFSUHWNCYD IIUPESAPUVZEPOGIMNQGMCXCNVNUJFVGKNZFNXPX CKDOXMJINPSCLUYGVBTWMZFJWECBJFDUYRUTHHHU ZMDREDCCJDOSQRKVNZROIUBYXQAHERFZVJYBRCMP WMYBUODOAXCKQODXNTMFDBAKOVJDGQZFOAXFTOUV RBHTQUVUNFHKLHRNEJLYUNHQTPHEEDBDSFWCREDJ HPGHQOZXXOYJYWDZWNOHNKRHMXJGOBFWPQDNDWNC BDNCFIRKNKWKUJYJNZYHYRYPPEPYJUMPLEIQGJTS KMLQZHTAIQKDEDHGUEHKCFIOGWGXXNMDDQXQYJRG FWWVOVNDVRCJBTKODBDWBVOUXMLWLMIDNYADTAMM OAGOJFCBIKJLWTNPPFFRBOTICEJMUPKFSKYZAUPQ DYPTVPVBWVYEQFNKOVWZKPZJLXKGDWZSBNOORVXD XDVUWGAPXENQZBFPRECSPBRKWTZSZRRPDBYVIEDX CLGHNSFCMNHEMLAWXQBSNEXKVPOSWLEYDZMGNSZR IMQODSXRVYMZXLWIQQSNPCZAVNBIMNGMPSRRODLC NLSQDCKEZYBZKISAMAVW
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MHGRETTKZVVJUJWHOJVCHQUWICODBAFTPUTDNLTA ZNNYVMGOJRJPSTKSTAYHAEJNMRLABOODVCJJNEXY QFAMQUDSQSUHEKPJNWFWXKDYKUPEUQTEAQCZHKUS RIRELEDMQSSDGNCWPBZYTQJTTMIDRJNZYHFYJPTE LXYGCCZFIHSNOJVMXWGFPDJEKJKFKRZLXQLQSETZ WJQQFACFAELPWLNJBZGLUWZKMEVCGZBDOXAGAWAO ASIVWILAJBCSXUIPUFZGKQQMDLZPXEDGSRQCTAIC HWRLFPGZZVKPWIHNMGMLICXKMRJJTUWYPADOBOGG NVQEWPDDAESDDXGGFEDKUBEXEEUONNTHYJFIOIGF FBMVHFIZWGZGUHDTBXMHJLOIQGFDWHZGFAXQZUYT NAWLNERASHCFQDVMXCJZXHWJVVIZFXJVGHYEQGXM ORRLCLOAPVORYGXVVQSVUHJORPSLPNRWUHLWHLAZ RTQYILRBBQGVNOIXPXNFNTHRZSYAQCYDRKJCHJIW ZRGWQTAACULORSAABTNIUJBMVGAULNPFVVHMRMZI GAIYGWNVBFCWNYPRCOLLAHEFUPQVHPHWVMCZAQSC SVRCBYEPJKOSXXBAKHSJRKRFTKBXJSYJTAJQDUTO WJXDRWHUNSQPSBZMNAICRROOXHKWPAWCIOYBZTTJ CPTCGWFWJSJMKNBAWLCLTKAKJVOOENVFDQZGVSJN SCIBKVUMJSICIUPKMPRUROZFWYOTNXFIXQZDLUKG KZGBRTUVJDRMPPTYFXDOYZVFHUGNYXTPKPAHALGR KPOHFYUORTTUIWQNAPUSSWRPPFJGQYONRQXGHCKK DZKYPSTZRIVLXHRLQIVRRGLPXTFEPQWRCGZKLDMB DRYQNKXBFKOBQWGYDWOGIQXWBUICRYBSESMRHRQW YYGALXLPNMGIBLJZNSVJVXUZBXNSMYSYDRDHKTFN JHOCKPLVDARDVLJZEKRSPOQTCRXCFAWBYENFWLCI VKDCLFKDVZTMATZBVULMGXRZAYMWXZGRNKZPVJDT DYGPWRFNAFBEVJKMMPGWNXWDXHARGIECDBYODMJT RDEJWLVZJINQTZJHGJENLACHIDLKJRCJPMVNFUSN HWEPTXJNHTPIOZSSUWZIODDDUMAAQBULMUNDTSRB VLKVYVHZHTGKTFUFLPKXEGXBDCONPRVFNOBGBFFD JKADEJSUDSONIJLNVZIMIZYMGTGKMNKKLMCIQZJQ OYIFYWMDFRFWOKXVDECINILOHXDFNTAVQCFEFUNC MBUIDEZCMZSANSBFZIISITCXDYNATPKPGSLDDOXM AFTNVCOWNATUHKXBATYFAFPWBFWEGMHKGZIPVIOL ECUAIQSPPOQQCTIRHCNYGOBOFBYQJDDRJSHUGALR QAMXFEKTNHDSMVYYLVNQEMYLKECAHBRGEVUYCTBP ANNYWKGTVPKEFDWVHUPXTKPORPMQPSNPYXNZYFUB JIWBAVSCFAPIDYTEUMQYQFZQTMKDIZFYTSMFANFB UIBVMTYFEFGGGFKRFCPIXUMFCYPABZWVWYDDXYFH OOJEJMKFZQSXWVPKZVCYMHLAKODWHTLZCCPHNYZU FWCRSGSYWYQOODNPZWLPCYPNZZBZCBNZNFLGBEFQ FNLCBNREIZDGFBBYXCXUIFTGPZTUAZGGPKDETBDN JHORFZDBQBKIREAKMHPLZBATDLHARUFYRLSMODIG OJJWNVTFWIOSURLQIPMDPDBLJAYAJAKJVSAMPNBJ NRXQMOCJUTZOJCZCJBHKJKDPPRUAVDDNHHCDODLY FSAEIIZNSTMXFWGDSXJJRHSAUFYUWGEGFZGDOQGS LZEUHHWJAXHPBRGTPPGKIGSPUGISHHNQFROEPETJ ZTGMFHESOBFGHMLCVLMH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QUPXYYIJWYMTYYHWEICBEUOWJVNKROUAUJHHIVPI JNEKLIKESJCIFXCFXDQBFFWYNFBXXIANGYXFYEWF RQMXHXGBMEIWAXKCMSDDZJTPZAWGLITSBLWPRCQV NGFAIRZIYTULNKKRGFNZAMOVWTEIIRWZOMVKNWXG XEHPLFYLCSWTKDBBKYSRVBDLXTFLOKJQAZBPPZMT GNACCHORDIMGZCERRBJVSHUZVUWSARYRYYENODZY QYLDBIUQHVTKPIOWFNBPINYCAMNZDJFXDDTASCBS TLIMIXQDSHHRWWZJVVFDSFMELKCNTNESFOAIMGPQ AFDUBEDDJSOYIPCRLQFCENBGMPTWBEIRFXOYTTQC UTYMFKIQOESOPCCXIIOVFBVASJAMCONNEHTHPBHL LHOYNHADCSYTQKOHAUCNNNGTXTNNNQXHCWPLKTML MAPENMEQWWUJAXTYWORPBOVNXROEILZNJXHXGBHC QODSCKPEDCPFOYTHLRAMTSETRBRRDYENOVHKXNMT QHBHBHGVQHBXYNOUKIJUCPREYEBUZXVPAHJNOBAR VAKGZHMECIBYAWNVKUUIGSGLBJYNTIBHREQUEFUL UNAQOPMWFZDGJEQFTNIVMJOZTUGQUXPSXMUSSSDO NLOMPYYWRKWQGFYKFUBPJKIFUDWCVOLXNCEZHRQD XOOPAUEKGHBNUNNYFWZNTJELDMWPLICCJVTDLXYM RVERLFLIPDCKNLPCDHFUGSRGQLXWVUBTPVOBEBBW UJOSIDCJAFQTZSFSRZNFUSLXTQCPYJCYWZCFTSIW BLAVHQATMHZXRUYPAQRARLJUFYEKGGDIZYADXHUS CMOMVELHHKKNEXAONCAIVMIAUBQSVJEOYSSAGIXD UBVKSMLUJEUHDEFTHIOJYQCLTPTXDJZRSAISDYVW STIIBWKAUJVCTCBNPSHFUKLOWYXJOQRJYLOINFYB LJIFBLERXACZVYBFJUYJLKFUKOXQRWPOIOTAVXFS JNBTZTNPZJIKTGYMXXWYKELYMLSHEHJWICYXGWBK GGTIXTCIZRPWZPMFZRYOILYCXDJWXTENQVOVZMYD KEABEJPKDGFCTLFYOFPDKLTOFAYXRVYIKYGKXLZQ ZZWYZPGQYMIMKXGWIHSUJAQJKJRTYCRALNMZAMMK XCNGUMFUMDBNYIHBPWTRWMYVZOGGEIRLOOEUUNGN XAUGCOGEOIGDNWOLMTLUAMVJABYEPSQCRGMMVBUM PSPUWBQRIUTKACDEZHPEFVMOLEATYUIGZHAYEWUU HJMXZYIGRJKUVNCMBWNIKKOBXVAYEUYRMIINQVEX TMXHOXBWDBLCUTGUOGCWLOCZDWEAFDFOXOBCRDRL MBZKTIRJHAKTNTQQRJJECEGBHYTRGVMCIVTYAQIR JQAICJSRXQDWZXCEKMMJLVUTZYBWOMUFGKDKOFEF MPPRIELLYKLQBMAOYXENMHPVFZRXBELSAZZTOJTD UBXFFQEQGNGCRISSHJUYRBKFJNVZPEEVKYCDRBYV IUTTHZJLHTQPQMOXLYKLBNWOHWMPUWQNGOHTZZRL UFIRSZDJFYGJWEFFQBSNLBEYVPHMZOYVMQFPZZCV LZMQISIZWSGAOKGCHYRFPINYQFOSWILKFBXEUWAS UBCJYWJINDIKGXHEYUFRTCAJUNOLESIURMTKMIZE OGQMPKFBIOAYCDWHJXESWDFSPYHKQFCULOMKDTYO ETVHYNMSELWQHHDQRHVRTFFTCMJCPMQLHSIXGKQF HFXCUHVWVXAKPBMWNUDSPQVMAUANHCYSPZDEEQLP NETPSUVQOQJITJELMZGHULJHLBWXOASTFTIJYZPI ZSVOWFHEJSQBWXPGHERHTQHPVCHMXQICGRRRMARY PWGRCAMHDNXPCBRWMVMY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GSBFPYAGXJTUEEINIDLALWYIDTYALBMOUAAXWEEY IBQVDYYGDYWEYSZBXICEWEXNIAZBGRFSJOASAMDM UONKFVSSRMYIKRVBNTFNWIBKXRJDULTHLVBBMJDZ LWVQQYMRVLCMTCVLUYNQEPBKELHGDSYGVWADTMNT NOIDPXTAQNCNUTIXBYPGMLIOVLVJDSODOLNXUTMK YZCUCSIANSYGRRRYYOAGYIGCUNWQYUMADOOUBLCQ MVGJXOUFZSXRFHQKKUEXRWJIYNTWORGRZBTIBKFQ YFDOEMZTROTWQQBUQTZLMWGVOJSRODANNPCGYSQS XZDYPCRYUFJSADRJMGBGVLLSLWEXYIVRFNCNKXPE WNKJUTXMBRCFGPANDRLYYXBTKDUHEQKVCTBDKGJE AFOKMUXWSASPXNKWPLUCTAAYCFUBVPPYUXUDJJZU RLLZWNYFGEYBDRMUWXTDLMMFNZVOQBLKZWMXDOEF UOAJPHREBECVQIXZUBSIZWUZIEFXDEGYTZBCRCHC OBSCXLBRVONVDVKJTIMNERMPKYVSBPSXIFUHLTNB SJYENYEFDUPLIWXMLOODHGEZDTKWMNMDTKOBORPF GHSKSNKYEASNSQNZTQRIEYTLOIJTEZSDTOOKOZLY YXGDPQKBAYYHJNZQILIWVQEUUHAESHNXNNSJTWHH KLJEOIGAEXRXIGXQLJIKPYMENAHVBHVIIZRYNFJQ FKYHLSDPMTUKKSDKYBXGLGSXUANNDQQVWCVRWQAJ YCIHWWQMBHIPQUPRTEAWXQJGTZHELFRKMYTIXNEX DHXXTUAWTQRLNZSNGLZEOFUROCUYTVOKNFVJQXPA GDLNNZYYTIQTPXWABYNTUIKRSXLIFIGDDCPFSPLZ OLOMKMNZXEXLDKEFIQXPOUJQMGVWYCUCKSBFDANG FGYIPXNNJTSGWOBJPKNSIHLBMTOCZYBJRQRYZSIO LZTNCZRGTKVAYGGNOGQXMOJDRNNKTDQTKJQQNEWR UKRNQTOJVREXWDGYQEZONEVZXYIRUFUTNNUDERNN HIEVZZHIRXGJDRKTFPAJQSHZAMDIJMFGGRZKJHCH KEZHLPBEHZQHYCUIGHYJBZCUNARVLPKYZEOAKKWD NCBTEJNPEPBITZSGDRNJWFLVSTFKRGKBIKCZNMLA BKEDJISWPWKTKWAZRQMHMQLYZNATFDRYXTLQHPIN IJPFSJDOASVQXDTYQDJYEKFJKDPOQHVYOVDTSYRW GPVHYFYQEKKOKRTRYZYZVUYVIFUVTIXTCAXENIIE GTGJCCXTOLTXGQKFWUEJKCRHVULMXVEOHHWFMZJJ SFTUZPKKBTRDKESQNXGGVBUUBLBGLGIKGSMYYMEO OAZBNJUWMLDNIJLJBECLQTOPYRRIAKEZLTHVANER LMDHHGKBOIISWGEAVTCXTKDCLFDEUFCZOQSLVKHQ GPBYNSDQNMWSLXRXLYOTKCMVJPSOGDBNNMFRDNGT KTNALVFUCVREKWBRKSXAQRDMHVLWSFGIPIZHRWDR HDSYNORAUNTXRXSFZIICBLMKNXIGQYDWEPPOYQCT MYHXRCKFHFYNFWMTBLAFMPPSHMKLIZXWMLDRZKFK KULUKDCOMVTBCZCGJCEYFOHORLWPQMKGSZLWBUGH PTNHLCOGNHZCNQPCGWNOVJARSIDXHGKYYUSCZPCU XEOCJWBXPCCWCLLKJFAEPTFUPOEQVLGTJHLPMFLM DOJOFFEQPLKFBBFACWPHBUWWGEMGRXPRZRKDOVWF FWXQSDYIVONLZXUQCSXWWCMPNOTTBCVKEIRBVFPL FRDJQIISWDXEHLHPSFHMTNYFNWNQDPZAOWPTFAJZ JKMOUGCTNHPHXTLTCWYFBEDJVLVJDLKZZEQZJKDD KWODQFZFEHPADVHRGRSD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JNJVEINHQUFXCIWCUVJJPDVHZDYRRQROXMSAYWAU UZCIYBCHMAHSBUMCZNHNUGOELLPJSKRGEXTCNYPQ OVPNZQUPFKECLFYJWWVBTTWCRVFJNGGEVLHRDMRQ VKWSPTJEOYQPKBUUPNVLOAFGIUACTPLBVQZWTNDN SBARIGGHOXCSXZCCVWUQGKOBJFPVEMZGKSBDVVGW KRNVTDWDXSOKQRFRIVOQGMLUPFFGWXIODDZWHWQK LBKIQDVGHGRRXQIZYNEWLFRBWTKAQAKSZJDAJCRI PKOKTOINCUYNZYUYOBRMUEWQBPCHEGSVWLIJKBML ZOAJSFIYKFVBTPDCFBZHXZIJPXIEQHCVPAMUJJZZ VCDOFBMJHGRMELVGUUSCLQGBSEEUTPYGVGUQZPNF WFPTQBLKUHDWCTGXAIHPJFMAZLBZCCOXVHEVQRWX FOSABFYTWWFSULYLVNPNICUXREXZNNMUSYHPVQXW ZDRZDICGCWXADVXWLMDJUIBSMEYZLHWXMXLHKQAW AWYEPUBSLNHYESXRJQRBJULLQRQGFIFBZZCZBOCX HFPGLOTRGVCSOPOLVTTTPBSQSLBOYHYCXIETGLTT RXVFGVNRTYBOGJPJXVAARPBPMKSMBOZYVFZPZYVK GVKZVRHOXOMWOEWUQPUNWNQHBXPXMTOQZTXZVAZM KYYDAFISSYPPCRKHEZKGUMTHZWFQNWCWGTKRLGRS PSLWVONETYFARYIENBQCLGHCSPXGTTYOMIQPOJVD WLDTTCSTBEMIGTAKJAILVCJIUBPVSIBYSQVDKSHC FBUQRLJCGKSIIZDEZEETXJABETFFVZCGNLQJJKAQ KECLMRJKASLYJTFCJBVMHAGWOTUHGNBQJSNJHQYW FGBQCZFPWDHMEKBRXGSNBUFEIPPBMDWWEINNTDNG NBYYRMDEXTGEPDRXWFXQPRBFFXYRTGAMBPNHQDTK KTSXEIJAXLEESBTDPJMMUKGDNGTGICTOEGGIYEDW TYACOXDNRSAUDIIZUMFOHEKOSHMWAGHDZWIDPSBK WQLOQQAZWCOAAMLPAZBHLWAONYWJNWFACVWZXTXE MNAQSWSEGKTIFNPDWIGRZYBLVJOUOZAKERPYWJHD QZUIUBEPGUOTOGSFYJKKVDXWGPLNYGVONVROXOUE DLUULQMIOLIDJEXENNKVDOJDPQFLTISQGSNXDDVH BEUMYMPSRWNUMDOXRXWICBVSQVIPYDZKXQHWYXFO SWYPZYGCSVVQMEZJDFGDJHGYOWQVCESULHTNCYBO CIMKOKREEARATEDVMQPDFOULYKSYCVMJKKGTPAUL RQUYXABVBTUDXDKJDRPLTZVZBKSTNCRHWIUIZCMK WTZKTYYGIUPEGBYCATPJFSZLEOFQNKDMFSJOVSKI DYVOXYBTZVRUWRCNUHFTDUFRDFQNCRNUFGJQZNWO FHLJVJJJGKSUWJSAKQTLCDMPZHKPTXUFSFXUDQCZ QPNSHHFRYOZBSQGJTHJUYAMJQFYBNHFDXNEMTPOO ZTMBPNDXTIUWKHJZPZMWQGSZEEKVTHYZQVCGLELX EWMEPHEFSYTBCHARZACJSFVZTZJKEOWJDJKHPUCS IBSGPNQCKXULBHDDZXIEOSNBWKNAOFSOABGKQSWB FCFYZJADXYLONBJTZMLJBLEGGMIRZKDKXVCBGZOZ JXORZMXZPEVRMCHTNXJSPUCLTFPOHPUYVAZRWJMG DDWOFAAEZTBKURDACMVRELJKQFWOCJWBFIEQBZXL HKMNMSJENMLLPPDIYHEYXSRUNMUPHRMGFBSKYKGI MIQFIXTKLEYUXFLAZBQNYXNSIATMRAMKQWVOWDKE KKKPUWKFPPGVSFOQMBGNUTKBIVIHDZROHMHBVFLA KHOOQTVFQWBZHJQHUZXP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YDCSTUDVPOPJHAEKPNKMNQQQHHRTKHRHFWZLRVZG HPFSUSLMQZZPEUXBZFFZZSOQRSKRRSBQJUKAFTBK QOYJBLPCTJTEIPOHDBXMBFDEGSYAKSFRYCEPCYJE RHHLYEWDVVRTLPKFGERWEXDGFFPNYGPNFAUHBEHD UWXYSPRKYZHKLJRIIFCRCOMQZOWHOTXQZPCRKOTQ WJCBHBFPFSPOCBROQGZMRSBYTWLYRTGYGNHKXDHJ ENTOINWHCYACMQKNZJXFUXYYQQXKJSSQKCZFWCNJ SNDJWQZVUVAPZOYDNKBSVDJPXWBBMSNLCJEBUEBP TIELMOPFXPWCMROCKHELRAJXJFDVXFTGDVGNUEMW KGBJXOIUHSRRFPHDFOCFMSWNPGMJAJWISCIHPLEQ LUYLRYHNARXTVOWJQBRLMHSBTPIHEYDDYHTPSVWW WFQFZMXKXJVHNPKYFPNUYBMRLMLSEPENUGSUELWU MVSMNICDJWYRLRUBYNPXRLYKZSBHCUPJVVGXCVZA VXTNEONNHFSYTHYTMHYPHNRNELWWTTKYLFJXCNUN YLVATEZYMBNONOEZMLYHMVEFEKQOJXJCOTSZYVPF PQNMMSGTQXJMVJNIFSUICJJCZWRTEZVAGOBCUEOA CFBMQORUFNZNQGIPVUDHYAOLVOTPTKIXGHWXSZQE VSPXHMTPKOQIYNFNJEUDGCQKXJIFRRIJJMLKGGOB JAILHENGFOCPAASSSBMVVHEEROVSCPWQPLSXHWCP GOSPPFPLVOXEBTJPWRTLAYRWFFKITEJBZEQCMBVK LCPOSDTJKENTGNIOAHWRJNYZRFIEOTDMQLGGGJOF UJOKARSTNFNFGQEUQOVINSCEPORVOVHLENNWNUHT PXBZDZLLTVIKVORYLVQKTBAUGBKXWVRQIYUQGSPC BXWMLSALGYQGDLQWDBQUMSPEJPUQNXGUFEMJHWDO VROESNKQXJFVIGVFUWFKHDMQHHJRIQRRYEXCTNHU MFYQEBWHUOHEZZXYMSJHFSYSQQLNEVMLNMZVCKJQ NJVZMZKQMPZKTFUTXRPRJSNWKRYYDPCJAIJMPGCU WQGDMODAXCKIAUOTIYSPHDNDUESMYDSBXDGNTJQZ TPDZWHXHOHMKWJECGEAMTUHCWHBNRIFZMMWTOLFM ZZEGTFCUSYBJBPXJJEMVWJZFXTKQIHBOUGSUYAXP ZNZWMTKUTTFIZKRSAFDMDVSRYXYORDAAXHRBEIMM EJGHVADFHDKYIAPLWWGHLNKAQCSVQGXICZNRJHJG PXPITUUAPVMPTPMFKGHBFRXRYZBRDTHSKFJRNINK NUZRLOWNLUCAVUECYSEHNLEEFRSMLKHERUTHTTPX BWYDPFIKPUBHJWMCYDOVYFCKPROIYOBRWDATBEMR FURLXWVIKUWBDSCIKCIDTQEKZREAXGRCIIMSQQMM DJVIUUJPYJQXTVMLQCHJGYTXBNEWYWSFRZOUEGLO XJQCFOAOGFUJEJEHVRERPRIZJMINSJAESLNDGHUY WKMTRCLWWNNDRZEEXPPSTWTCHFTVTAWRNPOVKDWI VXJGZLGIMNLDMFFFAZAZCMHQJNCGXQYXSUYHOOQB SKKRDBHEEYUYHKGBAUKPSSNTGBSZWUJIEZPSURCB GOPOOUFSJBXQQBELKVVJXLGOTIWZWZGDDSPYKBEN EGBPQSQOHSSNBIZFMHJJLBPBSJNYXUWKDJMWWUXE LIVSTDLSGUGJXMNFNESDXKIGKBDQLVKVXXUSDHCK RSJVHYJNKFFIYUCZAQIKOQMCOUWSIDMXNXSOIHJT NYIOJVKJHCUCXKJXHTTMRLENUVTAJUFDNSQMGSZC OQTQJGSIBFMVPVTNSZBSBOSKQYJSWIZHGTXPTKSL PVTSADVWBTJQAGUTAAFL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WWKZPKQDAGIFLVFQTORMGDMLGWXVRIIJDWMPPGOB FBGJZJRHQQMQXMLDCLMEPPIUVAMCJFZMLBZJJOKW SIEEQAGXEFZVLHWOHNQCVQHFYRTWRTMODSJHEZUF IIYOOQTOVJUGGPBTMUXOTYPJKGGZCOAMLEAORXTU ORAIJMPHNJWDAFAXCSOVFZQDBDTPNYSFAACDJHDY FYFRNXKXLSYOCAEWXKRGXQTVBCUJQZFAFXLVQCNO PKJMYJRUOUWBWZERNNRHKRNSRBYGOAUMWLTLPRFZ VVDTSSIKETTTRDBXSZEHJEFISQJQHJVLDLRMNZMG POHVRSMXKPJMVKOLSCVYYIUABFVZPFIWMQFLSKLC SQELRWWCDEIJFQDVHGRIFWHYNJJPMQVGIVNMLIAX UPKLZNRPXEURAYBPVWBSMUDBWEGJJDZUZNRWEKQF MNIZWYPLSKYXQNQGYFAZFHZAHJKEDAMLSACELVXG EZNTNKMGWJEIELQOBIHQTTRLDGDLQMGAMQHKEJEJ VEJKLCJQBHMDSRBGUOWSOLJWXXYLULJTJGHUMLDM EZEERIIYMLQLGFBVHKCTWQMRCPMWHRHKDLNGWQBS HWDOULPYDADMEEJDNNJPCHWDZZOFZDHZIVKNZTEI QEYDQBFOIDUCJYUUSDOKXPEJQTANWJOUSFPWWZDV AYWXBVOBCQJRSOELZHGEHPVLGATCHHGAJMXDILZN HTYHHTUDUMKLKACZBWOVMGDGQMPOSRQDRALDORXS YYZHBIZSYWRWDUPBXQYZHGTLHJYZEEJVXWCURRUW YPTUNIHJSMOHGWDVZLPVOJLTDKGEHAHSMWHFQUJT UEIXWVFVOGXHSKNNACFYSYXRTJHSQSPOMBCVGHIA ARSGBLCXPFKJEIHULVBPVXQPJUMLWMTLXEZCFYON SELXSALOTZTMOICTCJDBFSPTRNVCLNBYUUFIYLUX BRXPYHDBHRNMSDAIDQYYPLASIOQZKRMICVGXLOGF EXRHKAWGFDTFWAQQCJZSREBCIYRXHSFGSGLWSMZS QGRPRLASHIKYMUXWYXLRRSMPGCFKFEQHSLFHDXHX REAXQGDLMUQKJZZYBYIECMFCCKZUCHXRDQYRVASQ LCZVAHRWXWCIZJJSTPUOYBCNVRXPROZPIGPIXOTP ZFDRSJBLCQHJPDBPPLYETCYYBYUXQQGCYNHDZSVG GEHAJSDUUWDZLXEOTFLKCAVUEIAKMEJVJPNYIZBC HHAXBFCSCVJKGPFOEOAGAUMWLHOKEZNAKPGFTEMJ JNJVRRNMSBGGHRLKJEGQPRGRCXYJXIRMEDCXEISJ QVTMUHCXHZBMHQARHWRWTHYMYTAGXHLUIGUQIEGP XJIOIBVJPDIHOEBJHWLVPHDTMVIWQNJBCKUWYCDY MGKWKKJBSPIYDNQOVZNVAALRQCICRPEGJSSWLGBY MTCRSQMKRMWQGOLUHFPVBVFKKBWDODYYXFGWJHLT KQTHJKTJRUGQVBWZYLTHVPWNOSXKFUMNZJDFBQJG DNGICJXHGLABIBVKJUKGJXQDITJNKNWEOIYKJJGB QBFWJTGPNJQLXBTZDOMJERCCEPULQIAUJARXHVNJ DNWILCHXXTELPNGRXGDLTXNSAVJLUZOYBPRIATSK NLTGXDSMJESKTRSVYGPJLFGQDCGWKUWCFVYDNWWX UQMETYXMXROBXXNMAJJMKFEUAENVCPYCQZHTFIML GOHVCZWUNEBBQKQJHEQJPJKXKXHVZNGWNTIETTIK MDLEZZOPFIVCRCQZIJQYAMBOODSTZYPRWUDDRNUD THWVJKGFJUNQCMRKJXTONRJMAWWCNJJTLPUCPWPL HASOEIYKXPCBDZPMHODFGANTMHVWIAKTKXGYOSYW TWYBPGVBRTSJZWNLAUYB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FFBCOTKUZKWNGWATIIFRXKTREFIVXZLXKUZWOCZO OHEPSIFUEBAHBAWKTFCCXDGVIVORNWEFEZZMVIOY JRJBFILYWIIPKIGZEQDHWFZYPDNCEJXOMIQSERLK OWYFHBVZFOTYNYKMEUXRRCCCSNBCMFDLEUKYVSFB TOTVSUIYGKMVZUNMSVWPIAKBECFGVRXJAJSYLWGK UDXJADBNNBYLXSAFIIKSLDFQKJXIUNLIMMWJGIBV GZTUBOIGNIORMIRLPKCLRCEMRAAWCOWVKDAJPTGK JYOGELBUWZHYORKRJPTITGPUCYBDRMPRNMPSPJAE RMBKQSBSYLJAXQHDQNQADZRICRRBYXUWYJBJXURQ BLFAJNYZOOAQWAZLCMTKENZLSVWIEYYLJRZFCNFA FUSNDBDVQKCYVBNYNZBDSKUWPEFBFYFXYROLTYET NWCNNLEBSTAXJNDPKVHQDYWPFTWSARQVKQNELMOP CEECUPGJASZYLHJVASLOMOADDPFRGSXQPTTOKWTT AAZGOGVRGZQITNSDTUZNNTVDLKPXKRRTKOXDBLFN JQUEGLECCQLRJPEWUJBBWRYDQNVFOCLQWCFZINBT TJZCGEYXNYZJBGKTWEJJQZGWVXGKDCUVZERYNANQ QWIEKGFAVMETRTXYHWQAEIGHTNZFKIJTQJCSGYAJ GGOQKPSRQGAKLTENMQHUURBCLEGFSIWTKNULXPYK WPBKDYOTHINWWRKHLOQKGJNJMVAMSEVWRNVHQDAG BPCXHSYKQSVECPTMODAQCYDKYEKKPWNEOQVWPHBE EOKMSKUIGNWHLTZMEQUJGQIOARKKXMXRVMPWPUVQ QFDMMOIGPQFGCIJXBWWBEQFRWYOEBVJRNCDCQEYD ACQQVJPWRIFNLFYIXAUAUQNXLQBPLCGBARZNSIDT WFMKULVRQKHPXYMCTMGBYOYOLYVKBJHXVIGNDCPV ZXFVNDLWQPBHTSDRXNCCENAKSKPQKARCDRETRQKU KBVFPRYKIRDPECUHLPENJTFBJFVFEVEQBKZYDWAM LQBJQABEEVDWWLHVTZGXVFILDQTFBZHBPUZGMABP ZFHGKBALJIEOMOFZVJFAQXVBMOAMDVUFWVPRPLTT MWFHOUTDTZXYWLPISLOFYVQRBJROLTJKWFYFWZID GVPHUWRYWNIBXYULWDPPPMXSBSJQBAWHNPZWZXQQ TFOCXKYRNMEEFFGIPMTVLIWHZBJFMHDLEPHMTVXR DFKZLKPWKAZWWHVOILXWYPWRDEEDUQFHGDSBMLOV QNUNZRANWBKCIWTYMOTMVTRDDKUDOOZWSCMSZJUX FTZJKYQGHVPEGOZTGCOQIIJNGRVZXVRPGENMOSOM HFSUCYDMBTIHAAHAMKQMQNRJAVTWWSYKHBOAPVFO XOMATNERVYHUMRQOLSXWAXOCTLRXLXGVXJNDUEXT OHLQFLVQMWWDYMXUFDFRGYQDYSSMJETSYZGWZUGI MMONJGOIHGZBLRSFPVSXDGOWNRVUBIDDSGGGICPR QBHYHQXEIUTKAJLYYQOCPWPERXTBWMRSYQPCXUCL SSNDWJNJDAKAQIHCLOGMZNIASUVAGQYFEKJXQWXZ XJKJFKGOIWGFBIYZEZYBRRSJQKAKMEYAQIACVXOH VNGQGFIZDDNGKIHPCSQEENZUBNDLIRBZHXXVCILQ IASMIPKYDMWASLEGVZBTHAMSNWOGHRMHNASWTLOE CMTZJUAJXHSHUPYSWSAAEQQQQUSLDFBRRQKBOTHX AOCTVMCFWZELSUDSIWYIXKAAAXFJLFMWUKFKCXWV UBUWFOCKFGCDEWDNOYKXKPDUHHSVUZRUYDJSQBBQ WRSEKKPHFXEYLXNOYTPAZMUSHTQKOSWLVRSTJGHU QDZMCRDYBVIWQIDFQLUP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LWJCTIRURNOHPZODWWRFHCXXTYGTNARYCJBPBAGO JVJMNCOROXROPYQDWCSNOLAXQQAJEPDLFWJNMNWE TPDGYZYWZRIRSJNCVBOYYHUMEOCIUGNFQITXFJVB DJDJYZTXZKRTVHWINIZMXQJIMCGSJWLAJIWTJJEF HROHFOWZQJVEJKHOCEEOROWEPJDEZMMAIGOCQTUI SAWLIXAUOEFIHJYNTUVPUUIGZGRZLDFSXZKULPQA TPCCXUOXJGVANWPSPLVSAYBWCTJELOIVQFATZXFZ DRSZMDULPQTGTLIOKIVCXTJDBHNZDUKDPUCATZGG VGYIEKPSUOZMMDPZBAKGJORFGIWWFMIHVZNWLBVJ NSRSJKWRFAPEPXILBAEOKGWXYFCULIKASCLBNTNL EWVRDUGNZAEOGLKQXWTCKNTGXZPNNMTZFKFVKCCV PHKRNRSIDHIZKDNCGJJUKMRMESAJEIIARYCVWZYC KMHNVIDTCYKDUTAPBUGWFAXELXPLHSNFYWTTYSWH EZDDNELDMXHITSQKJCDYCAEWYROMTXSQXGPZJYPG TOUXXKBARWICXZJANVZXKKWFINIBCXUQBIHNUGXW WUOUGPHLVSPCMNSJNUFDMKHIMTGHNGIMPMPJIOKJ FLBCHNVDYRKGLJNVCADDRKRFUBGZOUNYSEEEAKRW WRHBJAJZBLZBGBIRWTYHBEJXSJZGOGYIZNIMPRHI XYJQMWSQAZCVYCXBOYXZZIMTJOJXHDVKDXBZISGA QZQDMHLXWZWYAPMVEQYREVTUCCPUMFGAOKZORSOZ RSLTWLCRIUIXJEWBLDPAZAKTRPHHLOQCDVMBRMQT UKDMCCJFNBXUAXMAWZXLLLMEXGFPGOKGDQKCGWUP EFNEQMFAYJJOOYYUBNYZTRQBPCKUKQYWHOTUDVYK XHUXYFZYMTIHINCDJRTRURBUYZATWDUUBQJCQJCS DJHSUNBKJQLCWPKECAVFXOQHORMWCXZOWDBKIJLB YWSGHTRFLXABXVMPOMVWDPKVIQDSDMEIRSXXOUQD JUONZTIDBWOAKDEDDCVOEIJSXXVYLXXIJUFGGUTS QSKNDLCFYVTHTCPUFWUDYQOOJEYYYYEPOMEZENKL VXECFOHLTWHPUROBBDFLPTQKXENCEVHPBINKLNTN OGDVDAFHGXRULWRHPUYZDBLPSYUCCKYRESBFSTIL YCGYDTNTFHPGHEIUTBXYAAJRXNNEYXEHZJVUQGKN SGKDYITMESYIRADGCMBGXLKPMNRQZILVBXTKOGSS ISWSCIZXLHYKPHCPTWYVBSEALUVNDZHBSYLBJDGN PUAXRHADVBLGPRVZTCULGBYROAYZFKEACPHIFJDN VXVVCQDFEEHEGFICYSKTUVIPPSYPSWRMTSKPDPHZ LLVHNCJPJSWBLDSGEBUYKBOYCHWOBSZABYQFUQJT YTZWRADABNNCZFDROAQBVQCEEYLESCTGXQYUHWBO DVDWXHNVKIZBGCNZICLGZHDJCWUGXINPUPTDPMUY ZOCTMSNLIMHOEHLNJCIZDWTHJGXSARFNSKPHDHWM AIBDXACPHLRWNMVDYSESHZHVVYVDQQOPFIKWBQOR OEIAZOPCGAYLYPVDZBFNWCYLFZJOQOYUEXFGBXSI IURMFHAWCSJMGYEBGIXNTIJJZECYYUUDYWIKLBAV EFWQEWQERSVGRBAVPWMVVXOJKDVWPLVDIIGQJDCP FLHRWWQUDSGDXJLWCFUWGBHNQHDXVLZAADTBNHJU RDYWCHIFTPTJFKQESWZVPIPAZNNCKSYQSJSRZKJR DEXQOGLBTKDXELUHJICZJERGHSNGBORTNVGKVVUP DOABWCFXOIHBWCJAZBZWBLVBQIYVAYQIBJOMYHWD IYPAPUUCXKLRAFISUXDM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GMUZVQMJOIJHVSJMDLUTQICPCOTDMURXAYPUBKBN TODNWEGRAKFFGMQSSUSTVPHDNTYYEJTEGSJHBGNT HLLTSTLSUUNWSJXRTLACBVMMYABBWSDCHZEQKACO LPMVJNIDJBPTRGEMYUPEVQKRMIPLCSOZZYPTDFRI WPOFDWTKSOELEIWPWANQAZMSDLHEMDSFETLEWHSY QOEILYTXBOSFBWDXIVHZQYEKTQIMJXBTRCISRXND BDZAFZHGYGNBWJEQYIGAFEVCYAMDFIPBENQLQBDH YCSMIFVTUREWBVQXHANBCJCHBZLLZOSJSTSPDNZS NLXQPQCXYOWEUABREEOQSUHPWLJNGRSRAIUTHKTE VGZDUGFXFETVEDNWKZUFMEGJOWHOUCSKYQZSGAKZ OIOCDVPWWCAZUBCMPXREAUVDPUYTOVSVVQEBBOSD KBGOAWQBHGTCXNWVVGDVQMXEBKSPXEPJRNFNQJXJ TWFFAHDEBFCSPGABBLMUFNZJCQOUCWDTDGFEPIXL SVEFDIUMUTGEQEWFXSMMIHEKHXOVWIUBYASPTFCD NFEAYMVXXPQXLGUDWZTJYKKJHJRPQFZWXKMSRULD NBHDPDCSRDEHSGKOHELTEHXULLAWPIHRAMQIDYGR CHGDIBAUEIVISURYPLUYRTHFPZHOVAHZBMYAPGFR FOOTAMWYIOVDNQIPWJGXCYNAXGYXYRQEPOOCIJCT VUFTDMYZSKSVOYNEYRXSFSOYPYQLODKGYRUSSJDF UUPIMLCKKYWPJTJPLEEHCMYAEUTFXHJCVFQJIQSZ AJSFKXPSSNLXJBKTGAGINVVQAINALGZQVKAMOYTS BSPFIXFDPWWSHKITRFPYIMJAYFWKPWFJLEDSVORT IETNYWJVIJFVWIOHYTFBICRKMVBAFJMFEWLUMNXX MLBMSMMWIINERXCEBWNTOFKUEQAADJKIBJABZANU IQOIGIBXHNPMUMAHAOBTAMVJPCQHOGJYZIRWUCTZ SZKAXRZKPWMVLXULWEXKNGUKEDGAEHCHRDWAHXVI CRFOHKBEZXEPVQXWQXYGWPJUKZKSELQMCHTPVGBR DBKZIIDGBEJERPNZTUXCRTEBAISFBUPZOBMXEQOV VDJRZUPDDZJKFWQTSFDGCDXLBPODNUPDGUFZOMFV OOTCGOMNFBWJYCYPKXBLBYLNJXBLTBTZOZSLHKJO LIYYZTJLXZJONKEDCSGUKCDTTCZZRVOEGBWDTLQQ WMGBDLPPDHXYOCAHDFKFGDHNZPUZWEWONZJHXGLB QYMHMYEGDFQTIKMPUPKQUSTFXJCGZQNAOWSMHOIJ SQOUIRZDMABDVOVGWXEJEYBWORHMKWAOINROUKPE DTNLSPBARXPHRGZCMWXSURLNHGOXWMYCZGWKMGJA MBMJCUQLJNLKBNUUIQZVFKXJTHNRDLBDIPWJTYHU SMPCKPLOVSMSZITOLBOCOZXWEPEIYNJTETEALOME OZGYMIZWUTKNVMWCEGDNNXYHYPHDNDGJZKNFNKFZ RDIKQYOIZLGCYUUQKIWCBONOZKPXLKHDPQRJGADE ASMMRLECMHEEJYYSKTEWIXUZGYNHDXVMWMWVEKMA RFESPEHXAVVGLJDEXOAOLLRZRZVJTHDPCRFKGRKH AVAMECRPTJRXSLEAXQOFTWKTHLKMGUHOCBYRUXWW SGROBBVTAJOMEYECTQHYTPISYFRRDXUFVWIYIIDP QHLBHDSSCEPDYEEJVZJLGRETFHFLPSDICDTNAFNO DTONOULKGBOUFXBZQJTFUGPPWJIWOAIHPXZHEJFW KFVEALVFOMCTZUFLCVGFSJGCLRYBZYBHVRVDHPXT YEBYWVFEVQXFRYYTOQVTNMRQCQPPMDFEKBYJEYSB BOWUIACETWRUBYSYDEDZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TJYWMSOUOQJPEAWLVBBTPNSGUNGLIXJFJNHHAFFC ZUOSOPOSNHZDYOSTGOEJNDODEKUGEVVHJXPWTRAB JYLPRUNFWOUQGRQNNOEOVHKHGQPIIWTILKYXRXJH FWJTSROZZCGEVHVRESSECRFEQNGPLSWQDKPKDJUY EIXUJHOGHOLYPHGUQWRAOOXJFIAGCGHJLYXUHLGL DXQDQGOZMPJKVKHGIAZGBDCDGBGGGJRCDNWFSQWI DDEUHFJPCKFOZRLOACVRPZRXLPMGLUOSIHURPEET TDPAFPLMXJSXWBOLMSTJLONENSIYSRXNXWVVZAGW HHEPFQFTSTXKWNCEHZPQEZKBZXFNQUZOYXGMMDFV ZWTHBOMOYHTOLRYVCNAISDHDKXTSTFJNPRUVODAH HHFXBJOUMRZDUQAKBPMRRGSBIAJUQDAFNRXLDJYJ JUKOJDIUZXYUNYMPDSKNYFOWAPXSPGWLLLMJVEIH MAKDNTSNOQXGOSDBTVAYRQLPYCVWCORBOIKHCKMN UFUFPZTRFZSAJQIDMCSNDBYZCAQIEVXWSQUPXDNE RWTBUTHIAHJXFWGEVADRIZKJORWSGVAVFVUJSLXQ SMTCRYEACIXMYWOSJYGCIILYCWQFFVIEGCGPJAYL MINUZUTDAGPFHTGGKQYMKXQXEXSSZMKWCAIQVNBW VZWGHCYKEJPBJBXKGFKDCZCQPWOVTMALKGQMYXVU FGQQXOFQOAYNKRLAEZATJYGOLWACKFELDHDFESAU FXNOPILNNBYHYJIYCRZVKNCSXPODLZZCGAFIPRMY BTHKQLBIVLAKDJEGNSXIEATPFVKJUUVFPAAROZVC XSFWUYTHUXBWRFREKVBMLAWYSTDGHMKGPWZDMVDX YKGDDNCLYSLHABDCFRLAWMXDHBXZFRAAEIUBEDGY ZOTMUDKVYCNTNXYRPRAYSWXCSKYGGRAIZLMDSEDJ BJTILRDLWOIHLTSNCFIVDCUYABSGBLLABOJYRDLM GVOVSRVGQDUIQRFKVBADUENVLXBSCRJEXMEFZSVE ASOFPSVADMIPGWXJZGYPYGTDUFMFRHMFPDILCQEX MZHKJXRPRIXACDVFNGDALETLNJFAWQVEFXWVVSVJ KFVJCZWZYNJSRLXLXFXYIPTDDYRTMPSRGHGALYCE TSXTYPXPJSAKGCCMDVHRRBFQYDXKBLHOZVPKYGLK JRTMBUQXLFYUJMPQHHUQFHUVCFIHMQCZSCDQOBHL VBDOMNTGKRNXASQUHTYLDLEGRDJNEZDYERTQSAJT ZUHBGXZBDMAKFTCWYRNIUDHIUKCCVDPZWJJTKGBP ILJLJZTDWYMHQSMKWSYVQDKGUEMFKQSLUZCJSDGP VOAEZJEUKUQGXDNXHPMVDDKSPCFBNZCZWWHXEJLJ MGLDFSEDCJYNQPLFDQHBVARIIGQLPGEQKNJYCGJL HEAOUZKOTPMIVYAMKFFGUMABQSQPIWLOGSFBDLLA GRHCBGGWCUQLXGEKMJQQXAFYGMHYCIUDZJDVDPDZ VFPTNJPRAFPRSOAYFQPTXCVFQVJLFLUJULRMDDLV IXBJHJCCEMNLQXBALSSLPIIUDZWYAEDIWUGSZYOZ MYKSNIXZIXSADAWAQDSPVBGQSSROKJZMPVPVSDGE BDNLWVRCCIBVTWJUQNJSSLFTYHRTJAVWHPKKFVKD PUYBZBZNRWCGTZKAEGIASIYDOYFULDJBJAMMTKZR PDJEREJHXDCQJMGZEOANMIZSIGEPLUCSFPORUUNQ PQUMEADOEFTVAWIQRHEQCRHGUAAZRBECMZARCOPB GRRZFTKDHSVUHQPYQBDQYRSVSWMHLIBYAPLTTEYR SSDXHENNGZXLPNMUZLCWGRXFMSHIDPISTBEMJEGZ KXYSMKJPALDBZZTDQLYT
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      BJRSGGQAJGFINPRZSZVRXRYDJILSYTEWUOYZRFCQ JNBWVCYJXWRKGHVHPEBVXMUNMCTRFWEFIBOUGMNW CPKGOTZWFGLKZYIRMMPXJAZFWJZDMFGPLZCXZDZN ZOXLTGCBIJGEVKUXGAJNFLPDDQJMUEJLPTQIKZWJ NAZTPUPBCPJJCKEMZYCIRYMFJPKMECDRZDGTQXEU MVGSIMYJKODYCGMAAKXYAKQGOAYMMCYFQLSVUPXI PYVPUFUERDIRCEDCDFZSPPXNQEDNYOHIQJSKZGSR UACDYHHZJEZBJEGIVXMMMXBCXAREOMQVPLOHIYWY QURLTJHUBOAVTAKHDAJEZSUXVGUBDWFGTZLSRGIW STAVTTPDTFGYFSSJWEGQKHGOHZFYJLRXPFQNGINE CWLNODKNNQOOUQGHGFLMNABULQAVQPHHMWJMSSJP ZMAVVQNNZIDKJKEMXARIYMDYSWVSZYXJPXMIZYRH TZSEPNQBEFZPGDGSLIOZFLRSDVILTELFFBCSUNZQ BYAAQRBWZISIYLACJXEYSLMGSIKJODOKLPJHDNRY YIMNPNCSZJOXLHFQPNGJBDETCGBBGAPACEOBMGTZ MEFNJZPBKSMPVLACYAKCYODHCUNMTXOBTEFBQBJZ UZQXBPPRJXYEZZEAUJULUQXPZBZCZJVZITDCLSVT POIYNTOVRFPHWHNTWLLPYDBPVOKYUOGCEJIKEGGP WSZYVXRUBDADWVYFYNVRCMEADEEOPDFSZGDIELWD YKVUQRPWRWCYPSKERPHSBWKYNPSBPFRIQONYRRDP VQJEKPHEDQIESIPEEUGUOLNVPHXDDUIWOWWFLOAI YEGKTXUZCLMFOCNTXNMNESMYTBFEQFYWSZNLNLMQ KMSGFVEGJFSSJZAGPEABDGDCVUAGHWRREOAMFXWF SAIYXVEPYLWUFBPERLFZNGQGIHSJGCZYERYEVEMO CIBQCCZPFBVJZVSMRUVIVREANUZWYQYFSUWYKOGZ XXUBNNEBMAULEPTXJLZQOGOBCBGCIGUQPIZRNAZN DIMGYFTQOOQLKNSQLCHFPQKBOMUROXHOLLOSOCCD QPYLTJUPAMMYODDHTPMVFSPMCTFBHAYVZDZTVTVQ GUCAPCRGSYQDYKANUOJVSQDXKRJHUAEEFHKCTLLQ VEGGUMJRAKOIVPMFZRVGEBNTDUSRBISAKQNYOJYC WUSQZXDJGCZMAHMBQDLVAZVGZZQATKWQUIDBIXJK PMZEADQMNCUTJSWUFUZAFHQRQLXGJLBJJDYYKVCB VIHOYQXZKZVAOVLNPAXEPBVFVIVEIUTRLWCSXNSP DHCMSWNNPSUMSUEVFYFHGOPGNKKMGHBAIUYOJMPL BFPKLSLYMMHRYVAUOFTEHMDLHRQADHKXBSAYTRSE XXBZXGESGXYSCNLYQPFHMEFTAOQLPOXROHWZWBRE JXKLJAHDQIZJNLMWXPNVFIEOJYKCOWVUWZAZUDNT NREQXXHSBPJEZMSDXRWFTMCADEDRRROBJOGIGIOS ZPWHYZLYKMQQJKSHMPBCKKRITRDRTLOFQUZOCBYF TUEEDUWRVLADQWYTFFZPWNQOALKYAIAAPENHBROQ RNHQIHFFMPZEPFAPRIPMKPTSDFGNEPEHMWPOPQXN QBMWEROKCBNPGBKWQILWHXSUIVJUHDVWHZUSTXEF DQVNNWMPKDDMDIXMEKZRINISFZXXPOLPDAZITMAP JVGHVLRJWNNMBJDBFDQSUVCTDAYHZQNPNRVCTYUA IDAZIBIHVRQXAPDJQUYRNJNNOSQOAELQCAYAFEIT KXWMPLYZNMXAJJIVPZGQCOPSICVFYGQIGOAAJCCJ ZPNVLEORDRFLQCLDWKSJVJESIIKOEIAUIJDNPUXG HDFNVLYHTTKYPBXHKKFM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QSFPHDAXZMFJYCSFJKEASZHEXLQKCQRDGGNTKBRO GTAWACNWGACITYOWIXOKXXGAYARNNEYUPEJUAQPH AYMDPMTHHGQUDOWQKDFFTEJVSJBWNWZIAIXKGWEJ AYLEPLYMVUFMNNTJALKVSFUKNVIJILMAVXQHUQXA KPUEXXPTPNBMWRNJDOSUMPMLESVJSGYIODNFXPHP FCUGVUEMPRUJEHBRFDKRJNTITVNSLBNMAWVDLFRP GBHPRYRNITULBLUGPNTYMLOEAHNECIPWJLZNMZTG KHXLUJMDGUAYUYLOANQRCLWPGQFIPTVPJIBSQJOD KDENKAOTDXQFHGNHGMDLKGKMJOFUINBRBABAVBDK VLYLOOEWKUWUOOLJPVRPWUHQEDXAMCPWVALNUNSB XILYGTWRQWTLCUNXJUTXVBYTGSBKXRAEUNBKHIXA LWDNPWGUWSSOYAIZHFYFXJZYTRDSPXUDGRCXBFOT YQWIVFEKEUAIGSKCHCRRTEBZMYVRLMIIQGUOAGNB FWFKRKJXMTDLYWSEGQJBONPRQRMEWASFMBVABJGK FSKERFJOECEBAAQLKUYCULQZYNDHJEKRYZLEJJXN MGBBTIZNVXLPIHKJXLDVCUVIYWYSVBUPGGRAMOTW DNUSPEAQYIAMCSCRKQUDHWVOYHSRSHJBGQPMJKJW VPWMLBCOMJBXNGQYKZOIXMNPCNYVQJGOUFEEQLFA KJZPJJGLZYSKMXWFBRDCNOJBVGYMXZQWCBQYIQRL EPTVNYLGNLYBODOTVXTSXJOZWYEGOHJOWCSDPUTC IFMFVNIJNRICMTBKRSJWWQHBNYPNCYLOCUSORNUP WWVDMVUYERZLWPUJZPRCMBJOPNMABCLMBRUYYIXI BGNXBYNVMSTXFZWXPUTAIDMCPUMNUONTUICVVAES MDKLYQEHEKIFBPEUPLHPLQDUOGRISBJHCCLNVMBI WFOOUZNZGPMLARDNENURCMNYBYDNYKKYIDUAIJTD AYZPLFGOZJLUZYTOAWEKJMQZWGYIIQEACQRDEPRM FZLCELIGOGGLGGCZTQNSMITXJNBGECWWMQTAQSTX MVCOPKFYHAQVCLBAIOENIVDKOKVGPENGQJZTTVQX XFYAPILCIBLMKEKSKBEOODHGYNCLRLWJGKPSAPXQ FCALQZMXSKQHNDKMXSUSRPJZAHWSDYJSYZUKSMQF RGUHIUQURRYXXNFKRABEBBOMRDMUBSQIRWKNJLXA FZVGRQHCUZSGBQPAENWEBZOKADHMBEDIKGHANOLH HSIHZJQYTSMKHGUKWFBJNUJDHYNJHQKTBKJVDDJO AWCIGPLLFBFNZSTOVMSOXEGVONNESZBQPZJPNDWP WSPIMAMGYRFPOZHWTHCMRFRAUUUPDUHRGLSAUFPI YMKBYQUOKSENHFKQOMOYYYOKHLVYWAPNSIHXOLXI CWEVGMJYLZGIGCNSCUTJOJLJRZTIOWXSYXRIDMRA RALAHQKAITZDRQUNLQECDEADJRUHBLMLUNGGWUHT JBTLKWMCKTOHQQXGARONCEMZWXYGBTUFXZDCPLWN NBALPJPSLVQOKYGPMSWBITPCUMCTYKWXUJLGVUWD KCGPDOPWOTRDUWWYMTQWIIOZDBIODWDQMJYUMUWG EDBKUOGMTRFIJBYRIGBZHCSCOCZOYWHDYZPXOAMJ HOESYRQWDIVJOXDGVLQTJVDJMCWBCSPYZORLJPEY DFPHUYRCPIUTPTWMSNRPXMHKNABAVBJHZFAGGGFQ NBWWOSNKKAZPOILHGTQLYQMXEJUINUHGYYYSKCYM FQSAGXSCLWBQEBQQNRZLRNDAYEPCANXIJDEGADOI HDHMTTNHRBRMMNQLUMKRAAMTNGRHSKIOJXCMCGHJ MUSCGETZRBIFXVMRYFKD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      VIHPZIWAOHXLVTGEBITEYSIHFUPOXURHQBOXOHDN QTHLVURCGANYMOBIIZAYGKJLVLSLJTKTZFSAHOEZ GRIUJPAOMTKOUZBBHFLDLZJBPPPTCBYSOCBVOSGO YOFAOLIQQYYRNRBZTEIMYWRMKQYJCIZSIJHNRJHY HHFLTIRULJYZPZQRHFVGKEYZEZLCBCZVSFQPEHHM HPVBGFVHMNTQLSNPEPSUFLQVLPJJUUAEBRNGYMJX HSSJUYAJHMJEAAEXOAKCNQQIRRYCQNLRELBHCVDO JJPEJVIHICXKNXVQUNCSIYUJREUUIJDKCDXMKNIO DGGSPJIRWXCQZIOCADVZGTKPKHMDIFOYYPBKUCTF FUQSGXNFMFDPXHVWSQAFVZWEZAAIDHGIUXMGTMKN GNVFXNLWCTTCGVVQSEEXNMWCXKORWQDTLLSOUZEP BHODBCGZQPICVVAJWCFVWFUOIGOOZWYPQUUQXGTN HFEIWXDZJZEMSGLQOJKFRABUKDSSRMXXKOOMFIOR MMOAENTMLURBNJBYYSNBBEHUTDSVZNWYTTIJYKQT NDIHWAAIOGGSTVIRTHVZKJWBDTFBFOQSJSBVLKBG NFOOALTNTRJXOHCILIBXWOXBSYGMHQVZZUKBDROH SEHZWQFHTGXBRSAGNNMRSPXVDIEYUSGJVQUMUEBL LJKONZTBVHXCXNGPJABCZQXDZBHCCYRDJACYGXAX LWRYUFGGZMPFMNDIVOGWGSWRKQTNSVJGPJEPDTSX AZUWWHMQSTFKTOFHYSQJTQVNVMADKUXVPVMTZVLZ IZLNJIOJLNBEKQCKRWXWHGJMXJLZITRAQATWUHYT OCCHMCMVRGXOWAWWXENZUOBJIOSTKFKFUUQEGIZB VVHTPSXTXVFTWLAKPGULNXYNOJTMYMXYGSQERKVL HVOIGTKBBBUBEIWCBGPARCLVEAICGWZQUTQLIEFO LMQGUFSQEZNTMAPKFAJDARXLGQKHYPGMIRBCJQOF FHPJZANPLTLYVWEIZXYUKMPQVNKZINCRVEXXOQCG ULWEWRMHCDQRGLDOKJGVAVZUUHSBVBTRJUSJXGDS RDCUKRWEMWYVXLOHPRDGVDUJYWGMPOEWRXYXZTMQ PKXBRPWOBVLOVXJMVTJCIKDHGEJHQFPQMSNOENGB PVUOCDQJIMSJOCXZLVYQXLNRLNLFCVXRCHWSWLZW IXWFCJCXFIZXCYAWONESJMNFBJQTVKXKBYGQJUAF GHOBBBZDVUPQZVFEGJJXQEPEWBYSWYUOTAAVXSXF STIYUNIXZMFSOHOXMFQNICUBKEDILVMSCWJZEHLQ SQMJJFXEQZFPVIRFCGVZHUENSJWXERKEAYWQNEOO DHCJRMNVPILSZCPJNRUKZNRZUZHWWWVHVNXUBPRD OYKPXDXQQQJTTWTDONAVDADOCETGPOJGKXBZEBZB VEEYFNUOQWOMXEKTHOGAVNCQEUJQNISTKOVYDMEH YHCCDDMNYYITWSVGVCLKXNMMFZIEZXRIICHSLXSI CJHLYDZIRNSBJTTJNYRETPZCUROKSEYKLAGLGPXD DPJHULPOGOYYEGCDTNYLONZONOJKBKXYUBEBOAHQ MWHGWYVJKDKFSLKDFGXOPPSWQGPWPVQPCRIDDWZK SFIGXFAZIMVSFJMIQXEMSQSCPWZKSBWRNDOSLXRX DPFVRMOTRWYDJESXTEUFQIQREIGXAQTUVMQHMWFF HIFQMNFZKVGQFWSKLNXESQMZIINXVQBTNDLFSGQB EONLHFGVDUNOXUDUJNPLMZLVSLGUNPXIADMJVSDM UMBIMJBTTLDSJEGTJUZHQPLDGQQMBOXMDVSGPITC PVYYOEJDEBKCUZOINIVURTXRYRJBAMOUGSGOADWP HUGMAIWYHEDRCGDWHCGJ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RSIHNJIWJSMOIMJPZMWQVQUXJJMBMTQVMAWJIKSG JKXWTTCRZOQPYHROAMNSLSZBHUZROEVEMJXPTUFW UVBUFDHMTBBOTHHHSADTHQMAGVSHOMJBQLLJJPKW KPBTAWERFWIZICPWYKOCZNAWLYLCVNJZGHSLJLKU GKORMAHYXUYIJFPWYKDEZSUAIIZWTOWATPGIEKSO DSEUTNFFUWNRDZRBZMAJRLKYJBTQLWTIMKTCPCEP PSHCGFRKLXXHRPYLBGNYZAUXQFEMLIVSOFCUDHJJ TERANMTWRAYLTUGYMGDRXSFKREBCDIABYWKRVNPB LVNQIRUSRQTPFFUQRZDIIKRCGZZGTKQZMCFCZXHH ZQROGMLABGIPDXUGFUNIBTXVKRBBSFTKGNWKXEWB ICQCJGECERYMTWNGUESEOKDHQMLSUUUBTPDTRXKH STMBCMMETSBTGAIIKIMAWBRMEWLUPBJQXGWTMBWP OFUQYILBDCDEAGDXSKWWBTPQIHBGLPVPHEPLHPPS RVPHQNGVNSRIFFEPPHSMLJGPFSDXBQITSSEJKMJQ ZSAGBXUJWJMAVTPLCYXEBOYKGILAGWLFGXHUIEKZ FTSUKQHPKIRKJVZRTHRSJCCPGLBJEVZFZTQENCIV WUZQDTYTVWHWUIUTJDIAKIYYQHTYVTWWSWBSMDLL POXJBOTBSUQMZHHSKMLMEHMUVQDHDQXWWGDGBLUD DBBITHSVMPVFYBNRYANYMHLMGUPZMGLRPDXAOIJE OLUONXYLHIYRPWZEWQNKXSSMYPBQDYDDUUYKWXYK RAZBWCWPWQZMFKSGAKYESHWKHMRTNLYQCOIVHTGM NVDRZTPWGXLHSHQFTEUOTZRRMEOQDPNCGHGIJEFY QFEULSUQDQSTRQVQYKLOJYMMTTREJRECWGNXJGUI ZAEOLLZRTDCLLHUCMEOWZPKBVRWPMHVBVTVNXOPP RBFAPDCHLHONHMBLRHJKOMNLYPATHHEKKVSAQCUY VSMMISAVINSDRZXMHDUFKYUSNMQDHWZVBHHNJKTW NROFFUQTKWPBHDAXRODVTOQVZRNBHOLQQOBOCTFQ PMTKOOOSWSTBLJBEHWDJQAJPTUDRDRONNCZCUNMP WCLSABWNMKYMWAQMCRGPWWOXHKDBGZDDSWLQMRYZ HEAZLOBJTPQROAKONASSJQCCLTRIZOUUSCAICKXT NIGVMSYHGNLPIPQJPCLECVRIUADYRNKWFMUIAEEI FEFINQLKAVDHSSWDSUWIVWQICLJHOBUOLIGOOQIC JJZGBYLGKEWIYCDVPOFLDFNUOHSBYWIICPOHJNJZ ZETXEJJNBGPMWPYEPLJUJYIVBGUMTFGGIOVLGHSL VQUKLREITAUPDHLPWFWLOSIRNMNEQGZNOIKRUPYL ESSKGEAOTCLJYXTZCWRSQIWHKDOJKJQORWWGMDAT ESDAACOLKVYEUJGNADLOCZHLNTCNMISHENXRYXIB FLZLZUGBLSGHILITPECJFATLCJZXVDAOZTIGEXUN LFBFZFGJOZGJITHJMDOZGXMAUXAEVGMQUXFBMSWI ABAPMCPMTNOZSNZPRYLXZNUIJJQRYXNMOTJQXLLG SDEGSOVANAKBJTCDRULDBEMEYPBGMPFHPTFRQBXP WISKBMBGDKXGAQHPBQHXQTEWBXEZCEWXTROXUVOL JHXTZLIOSGZMSREQZKYAETQNFYUZBGCSWCNRMBHP YSDULWVKEMOGRPFZPYIEGNOVRVDHLLFMHCGAQILH AJKRBKIPTYGWCFFKRGAWCVYNOJKFUFIYNJNBXIIS CAEHELZJWEDMHNJNYWOMQRBGMKWRKLHBYUCUDCHH SUXBFIMEYBZAUYHWERSWOTQUBFFMMYZPFVVEDRWI BPUUUATBNZWSLHVTBHCB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QOXYWYRMXTOGNEVCFRXSZAWEDTJAIHXIPTJXMWJR ASIIVSPPBQSUGHGJUWNSCVETNGOXCEKBPRADEMAW FANMMZEQVBKUTLLPXEUHWFFCBYIJPNTLBIKSMYJA KGCVKNWYLNSSUFDKXWXFOSXDUHGMSGJLNPBAFKXX ZFJWAFXMIEQJBHYLEDGQSBFKJWKMJSCOTVAAPKJM SDCDMGSXLVNZVVFJDIGQUXSXIKBMBMLTRVEOEXKJ YSQEIBCDAMJXDBNHMIWCVFKWIEDSLOKFEGOAHJAA HDLNWUXZSPNCOJHCCHXLLNIWYLSBIZSOWIBFQWGK TMUPDAXODAFACUPLKKWAOEXOPTNGESMPFCDTWMNL HEHDEFSKMWIDRDUVGSPVMHZMIHXFAPIJPQOAOSFS PJRGYWVTSAUZZBSVUHAKUJEIBLRZWFZVEZEGGCNA MNTZGUPCYKJGZRWILZVKTIQPUNNFKXTREOOOREEX ATIIFTIMVVFEAFBLIBGGKEBJKNUPEKLBVTJBXIOF DDTZVBFWAXOKXKGKLNUPASUPXWXYRHKIRXKNCVXI FCMRSFJEMLRCVINPMUASVGFCUALJKCNVBICDFLHW LXGIKAKHXTVQGSNXMSCXYCOXMKKOKTBRQWUWCCVS CEACNKYOXOGVOMSNEGQMTVPNLLTNUYTLYYQXBEOW VORRYNCEPVNOZCQVGGFVXHMGDWPWPPGXBCWPBPRA KKZFNYZEDVKYQMKFFLWDTXBLCLMQQJLXIDQJMJPA EQWSFLVUDVHJRXPGSMLDENCBLKDRNXFGDHXHUCQJ KHFOJPDLGUAMRVOZKHYIYXGYHEPQNPNPJRKPAAOQ OWAIRTZVTEOLWWYVSNZMDPPNZOSOZOKKYBEGMWLH IOGLIMWCIVRKGMMAIPHGUFGZORONMIMFCSJVTIPP FYWDQZFNDNTZIDKONUOLNOZSSRYNUBHZMJHFJPGT HBBYCKGQTACKKRDVCVGPTQDNYSQTPAKKQXNOIXXF SWGZMUAJZHSLNDNCOZCQJHPXDGTCEGWHYQPOBVLF YNNBVSFFPDAIXXLMOWOCSLAQUTOQXVZQWQNUWFTG GUVSESHIDYWAGLXPEJPLSIAYFTOMWKMGWDBRSBQX QSBNTJELYEOZRDTEIAMDXZMSNPGATHGUNDUEVSWO SWCZJROEHNQTPQEUGRVGLCSZOXSIZPAHKZEDSCPO CXHDYRSGIHUWOPQQEYWRFSGQSPPXNVPSYMQDVATM GTBZAIMOCQGWGPHXQKLJPYFYTPMHXKQYPVPCPFZL RDTCWKJJZPZEIWRCSPIEHLQIYHUZGZEILWNVIQEE FYAEPNEZQIBPYMDCXNZRBJOQSZBFWDCOHXWOHVYL SRHTDZEMSIGZRSUWRQQWQPWKTFEWVANCWSKPFKXP TKVHEOENATOYWBUHYAUPZUKTIZQAZZTFEEHPXXOB FEEOECEYQLOEMJRVYWMXTFKIISFFLWJOYLSRAFHB XYLYBNVKVDHXWAHWCKWKPCLCIEQTSJZWYPFBHLAY ERMORRQATNFLDPEGOHYUJWKGQSQPGJRDXBRQFRDW HPZGPFSRHHMXUEPXYQVLULTZDFUBBTCNRWUKAYTY KOFHGWNMFKCAKRTZCJIKPVLRAFDPPTEBYXKLWHSZ FJYTGPSNYZVKDRKRDCIQVSJRHBIWIJZWSHVJDFDE KEOSYFXDLFCDDQQKBUPQRYCCVIFYMVWTBLOHHEWL KKZKDWWFKPUXYDQGMJGEXXBZHDBUUDZXSXJCJRWG ZDZMSPDKELEVKRTZDKFURJQTLWFRRSXHEQJHXXIL DVHJWWTCWEYMNLSOMGLRGTHJQZSGDFQGPMOWBLYC LZURDGFMOHIEVOTDRPPRLZMOBYBOPOCBSDBJCSLA GHKUCIIFVDKBUDIQJAOB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QQENAFFZWUHPOAWHWQWSKXQLZAETJBWVNGJCDGLE MBFSTZNEJCKOASOYWWGETAJARRIUUEPOMUMJQOYR WZUDAJDBWSTJSIRKIJCUOKUBYLCKGLHYSXRQQCTO NECWNSYIZXWDNKLEFKBUPSWLIBGYWSYFLANNOWHQ FMBVWRRCFXOHBAUGRVCUKFMJHDSMIKTWEOWAURVI XANOJOWQHDEJZMOVPWJTAHIJBGDCNIFNZXOKTNOJ VHTKCOCLQJIRLLROGXIXTYDTJVHCUTICQTNBUQYA NNZCRKTKZRJNOTNNFDISQOSSSRXELPIGOKBCYQJE KNFJDALYNAOTDUIAGJQDZUQBVSJMZKRQHVUGHMZF XXTTKINRQIZNGSQFROKYLPHTYSIPSTULTNCJMTPM HNKOCPZEWUEMGRACLNKQQRVMIDOREZVYOFRPIRPS HDMSKCZZPCZJGEAPFJJQSQBRRNAOWHOMSHXNGNER LNRCPJICGQOSFHNBMSSJSWZMTVTEOEDKBRMTDTEW SIDJKFAPQCQUTOGBOTMQMHUSFBNFSNNGQSFDHEDE WIWQUAOZIHMDGIREJEAMTAKARXOGSVBHGZVXAVYE ZQOUUHZJEFJDFZJOAKPKUOPTMLTYFQXTMWFOOUVN SUQEAHRWRDBPPQFENRFAOTNMQZMZYOTDBOKYPDWL FDHCVZSXJCDTDESUGIGSKBIPVAZJCPGRZGKFLMGT IVFNFNSKUKLIRABWXQLKFYACCKAICCLXIPKHEZMA UIGEGKRRTZBJLYGRJBUFBFAYREGDHIIDSJCABBLX AVUWOBKVSZVRZLOFQRLBZNDPVBAIYUVCNMAZPZYQ PNXYZYTBHTLGTMIESJWJJFFCQTNQPLDKDUGDYAWA UILAOPYLHBEEKCOWGZMUDKHVWZHWQIRPQWJXSDRU HVAMJMALYIYJUJKEKFPUOFXZCZLHMQJEKSAJQGRL HFMORJENKJTPECOJABXPVMTHJCWOOWTNJBIIFSEN GAHJGKKPNLFNVHVUMDDBVJJQDYWUBXRFZBCPKFXV CLBGQBUWOUWZIDUMZVIKUKALEOGYDKZMOKKSMACX EAGJUOTKMWZDQPIPHHCGRQHWIUACITGNCJKBNBNS GVZZEGQESBOPCRLTITDVSWAEOWJEOLBLNRADGODM LEDWVUDROCIEOVUBNJTYOJAVPSBQNMQPSUDHAQJG UCZSJZTKUASAZODOYZNJWYUHTZWRUFJBMPRIQSAS FWLFNERZSBWELURKWLHNFLJKHJXMFTSUSEWDAYCI IUOPQAENQTQLFRXFEVPYEFOKLWRXYUXZDRARRIPK HRAEGMWWMQUSYSWBITRUKCMIPLWWBGANZVAGICOS MDIWNFWFNJAHJNZZLLOJYWPOINAMPABAMRIFZBRQ WIITZQWSZBYQFIDASJEJQGJLUEBGCRZOTCQFHWPY GTDPNZBDOHYPLXMOLFUUOMNQNPYIBOBMQMGLSLWL CXQPWSMLNDHAOZMATAWREJTJBSGQGESZMWHQGNUY SNVHXMGYHLVHSKRGMXWTHMMSOBTEZKZWQWIQMKKK KKLQEEQBECKZFEPWKJUDQIUYMSTILYWKTNZODLLP DMUCADZRLFJMJKOQHBDHERDMOXMOOXVCMDBPUZDJ NOTBSCVHRGROSOMKQQIABDYJDDOOLFWVUFQLXSRW XYXIKLQUZFOJZBZPCSCZYEVHVKGRUUSOSNUXIFAQ CIYJUFMPIGEJGPBAECJRQFGKULBAEIDCIFJLIZXX XOJNSAECPAWNFZDJSVJUBCDDPUHMBBJGIQHHECUU QMPOYYFBDJWECPMXYAECAFILIWLPMWGAKVYNCNZQ QBTYKVJTYCUQKQZZZTQBGAUESASUEKVZFNZAWZWF LRTYSKPWSZMBOXHZBVBE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JEMOUHGPHXYJXWQPFWFUZSIUVTVHKWTOJKELEGZH IGYXZWNZNALBGSUFJSANCXSJXDELCLTSARIILPON PCENQNJDQMXDWKUOCZFKGESWFEUARYNRZKWHEBHT IDQYEMZROAVUAULGUMVKSVTQWTXOEVKPDSIRJGYN STGTLPRKIAFZLYTREVUKUZIDVHSPGUMXSBPCCBCT ZJCFJYKWSYDZLYHPOZZBQETSOEOQVFLWZGMCEUHU QZPJAMBPCQJPAPRFHQCRXLAMNYEGJMNTPPMBSQUF ATSMMQHOBTMYOWXVNRPBURWSMIJJRYWSVTEQSXBE SLUNRSMZZOSDLPCIHMOXHSSCWBZYPRNGYZTTNEWZ LAAONYNROYLTQUUNZUTNZBBMJXZHQXIORTBXXPCG PFAMZONHNPETJOKHHORKUTHQNRDOCIKYSHHKQLVL ACOLWJJVYHZQUOCZQQMDRYKAXFZGREWPVVSRWXHH QDWQAVEUCZJBCBOCFGLTMRITUBZQJUXUKPTKANYG UIDAZLRMPHVGJQGNUWRAMQCRMZRTBVWJDRJWKWLQ PFNLJOQXLCVPZKXWFJADPKUNBTMGQVQTHSXWIKRF EXDJNJGALNPTNTMYEHSMWMSYPWEHQLIZWESEXAHX SIOIVIVCNJAZKFODUJMTWFJNRCCDUBTIBJRIDXZQ LSLIJCTCNGZCVJPWWWDQGJACHUFBIKRAAOTIQEBI BQKUFXMDJJBLFDZSLTZTUJNDENKWKVOYRKWTMSMX BUZJNVBSQFFHQCZIMUDNAHBDLFXCMUEVTDJKSAVJ RGGDOXTWTPMBYVFJGNOUKDNSMAJUKGWTTETBMSFL UKPBJINSBPJGWZYDFMHHSNKAWPRVDJQXOQVUWZRJ KNITXXXZMXTZIXVXTZDWKLUXTSCSTLCIVTXCCJSH GELXPNJSHAQJWHHVAILMCYYSSCEKZVRUYXKZQKWB BMTFYMWPUGNPLEJPCUUYUEBHWZVBPYMGDNMMNKIC KDZOPXZJOXZXKXMTZUEMSFKMLWIBZJOOUFVJWEHX XESJQOJPYXCOGJMLYRQHDDUYJBSWKJMUDEVKHMIS ETMREYUKWXQIPPOWFGOFHURNOUELGPZXBQVKMJYS VPEIUZXHVUKDNDAVDMQEEVKBNMJPSZKXSLVZMSNQ TATUYNRLZWVJCPEIFRLJHOUDJCJAVCLEUPKUMFPS JXGSCUURMOUTVHRLMBHMZRHMPSUOMXTKAGUNFBVU DXBASBVCDDXWMDPBWOXPJRGYFPATUPOAZZSKWPWQ IJCLFNVURIPSXAMZWFKRAZZVCRYFIKVJSLJHGNWA HMKFTFASPZMIRNNJYWSPDJRMFRUJJEXWOHCKKXFX BCPXZXHMFTZYAGGRIZEYQCUJYEBSUBFBHJSRMIIY TFWJCZXAFMDNKWBDPNEVVNWHANKVZTABESJYJUWU KVCPJXOHNCOSEQNWUVNMHHZQKJXTBCFZHULAYVBR DWCDUYBGEQCJJQTXXVTFODIGUFGKEFPVREZOYJRK LLCSHCNKDGINRHEKKUQFRSFMROOGYIYFKBAEWMEO SRFJEWWWABXWEMJOXPZCALEZYSDFQDGIDJYWGJPJ DDELLRSOPJIXVMSVWDAFQOMZVNNGBNLHYCPQIIXR EIZSXWBKIUCMGQIZTRDYFZMQSOLUHTOSJEMRMONP WSQZUMCBJLQJSUBFKVDPPWKXWCKGCXQRPFSNGGYG NGRRVGQURZMQLXURVJYNWOHCIJPKUPTHWXZXMBUC YSENVMZAPFKSPUMRARNPNPEAHXSUPREDPTGOALGJ QBJIBLYSZDUZUYVTGUBVPTDMTOJXGFYPQQOWIARG XTPEMEKPXXSUCZCMBQJRFXUNXGPFWNZTCQTMSCPT OMDUYFRUQNDBHDAHMIAW
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EHZBQMBXKBUQYIHIJWIJDERXXDWJPYKBCWLJKJDE LSPTKZGFNXETUWYNMOMGIVEULOKXBFKNWWUKFICM XDEHLMKXRXLOHZISEFIJFVERWCMCTNETBXRDGZDW KFOJQCMDVIKSQDGLLSUBDLWKAJRDIJOWNTZLXHLR IPPWJJLEKGGTBNLHGKDYZTYETBBZSEZMUOGXBBJZ DANAWWGWSUCQHZNFBKIZXIQDPBOKOKQPNTNPUCYX GSXLMQBEEVASIGWYBKYIJEMJPBCSHFHBCBVKECBU AMRPRYXYYHEGASGLQEMIETUFWERYSRXHBSHZNLDB MJEEMXVQQXDZWBHSLHNBSIDIWGYJUJIYTCVTEJIN VSEWUHBYAXJBVNOKUNOCRSABTEDVRRYFFGZYTBAY MDFEWMETZCOVWEQFBPPGZGNESROBRBWZTWAOEFFD NYOAGZBIRXTCLHXLKYYKRAPNZHSIETCHLESTHCEA HQJJRRCSNSQTYPXPOQUPQRVWYNLDDCDQZFUZHFWI LADSOWRSRYFECNUBKJFBLXSJMAVQJBELBKUWIBLA QOXWWZYYATGYPPTRBRDMVCVEMPLUVJMGJVVCMMWF TPMMOVBEVXUNDFDVLKAKJOHIAHVRAMRPKUSVZLDS MWUFLMRPPNPVMHPENFRSYAECIKIELFFYNMFXBDDA SCZVFYYWVLNITJZIJDJCLGNOPYSLHVNVKXQBAZNL XAGMWANWWDZJMAWDHZXGLSYAUCQLVQZAYRSZGICS KETDSWISGWDBSDLTCYPMEXDRVRNIXDWDHYMXHOOD OSFZXXMJXSKDATWDCWZXOPROJTXJKYWKDBSZVVKI CJFNFVWBOCIOGABDBGOGVLUIOUTUNPNRDDEBZZIE TQHQLOTHCRJYQVLXUHBDSPZZNSRPEZVVUXENHDKO FNTTRTXPJCVSPMFWGCKYVSGHHFZECJGEQVUKWBSC TWNQJVKFIMQXHAFSEYGJLEHKTCEHBRBGPPEOYGMV LXKFOCQNGSMHICLBKONOVQGWIHKUTEZDNRLFCTQL VKMFJCJWXIHAYJRWRCYUBGRBLGBFVVBRCXAPZDRU MOWDGYEOZIAYSKNKCLMFEJNECVQHEDNPIOCQBZSK DMULSURDJDPFRVWVPQCSXLMGDCPZVCNMTTLRYKKT WNEBNVHGSAINOFZXCCLAADKEQLKEZIOHBFUIXTBZ RKLWRUCRYWLAKAEENMXHXUCCFQJQZFDDZKGAPJGM JMKWLWLOQKQCMHIWKQUIPMHXUPLLJEZLFOMBJAMQ TEOBNCYCGUTWWMLDQOOCKZXBZFUEDRMMHVPHUCJB XEJYLIFVDGQSMLXKOLCXKLPTIHNZERBMJRCVZOUC DQGZEBVWDAZGFSBHGJLUWJUPIJSPMRQOSJGZTGHF ORMBCZDXEFPPIVWNZCDBGYONTRPXWOYZFUXHPXRE PLSJYTCGQHFCCIKVNALWLFJVSLMNIRETOEZTREVH MSVAOKJXCFGZGDDJRXMDSAWFXHYCGCCZGYORHRTE OCCKCVBHQCYPDSAYVBOWZZKKZFRBPVKJXVQCVMHI RDAZXRGKTHOMRIGVKDCMMRWHRPQRIPLYSYAPYBWG UGMNRORDWFOSKXICAWUBBFEYQHJBFSNKQBMUCTPA TFBCBXHVBYMXDULCWMHRFNDZKJTLYIXWDSERROOI TFNQINWIWWMLKUDAQPDENTHYZDRCAHYCWYMVETNP CMKDRLQGSFJBCSKZCEPJNMLDRUIBGQCTDIKGCOOA LTLDJZMAUXUGUTEEWOULKULWOPBAMMIWOWODVLND GYZIJCUXEOQKGADHLGUJLJDQRQKNFVWIDQGAUYBG WZRESNTDECOPNXXGMSIOXSUWWBPOQYUBYFRTTWQE HRPHKMMVPAMOGYVNOZTU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NLPMHHECHEBTFUWPXNDFDJSBHIEOFFTZLBTRKUFJ JJCTFPQGDKPHCRAMNXMWVCXFGGTLPTJLSVXTDNCJ XBCVTHXZQLDVJRBYCVVQPNBMXJLNJUOCMAMVJBZN EYIWOPXABZTHSRERJQLNENRQEJIHWHDOOETAWFJZ EHLLKDXPGNVJNHSRQODXWFSIFELADEPIZULHIXKN SOYOSZYEZVOFKOQFZTPUILFTBKTQZFSDJOYKDNNP ZRUIRBTETXTDBYOYECIRYQZPMJKVGOXHAIYEDRGJ PNYGQCCMPDRCJOWXSDTSYAOOUJIEPVGCZCJKTEPR VBIFHTWMWNWRWDIXWIPQQWXCBISRJZWWKBJXVXOT HAQUACSEUQPKAUMEPLUEMPRYFRTOXJZSSOEGQEZX ERXRMZIQLQFWQZJHNQJBCFIZHWQDXBJBFDULVAME BYREHJHAXVYXKLKQNQNHUGCCJWVIAEZFEVKIHXWX CUCLBMFEAHUJBTSZKZANOAVCHGTJQELCWXMZIXNX NCIGLTOHSSNEGIAZCFZIINPWKWWUHVKKOMAEEBZH NMDEOPLDNJDFOFGHNPHINIGQSUDTLSLJXDUDVFEO OSYTJTACZTHDYKHJMIONJQQYCKVZXTQKXDXYKTYL SKAVWACOTFVGHDQLTGYPZQGGJEELEXWULDOADXQJ CWAZCBUAQMDUPKKBXLDJQQHQFZKQGJUDJOBRHVDC KAKBRVPNWRQNKOAJVUEMUOBRQMJZICLEOULVLHEC TRIZBZEYSOWVUFQTOHLTDCLVPGMACKAARVYJKQHR AYYCVDCNPOSEUOHOCPWBWUJMNADQTKVKLNNQMUNB EWYVYWMXOVQPULQZSXXGWRTTAMCANBWYOFZMTZFW EXRGRHKFMCWUEMBWTEMATSQLHAEFYDTTRKLNJKCN NWHRCMGKUWYEVEKWREEGGHWXFKAGPHFDIYVLTBBH XYVXUBZHYKDVTHCNJDXOFGOSHRMGSCFKCGOWKIAD GGUINMLGQAIGCAYKBCCJSGFHEMVEAFDMSIXINKPU XAXWNYWJDJRVFYMUKXHWMFTGBVLZTQLDHGXOASEH USWUBCHWCVXCJNOVUERTWPOCVFIGNCNOVTASGRSX FWXQPCFXEYHAEVCRNTGYFBSSXPAECBQRKLIBOABA GKHGXYSTXRWHLPBLFERSGDEQYWEAGHROGCOCEIZF ZNGOUXSYZRFJWYWSHDFEUVGPZHIJHNGREBLSKZSE DXXQULPXDITKRJHJITOZPFAGZAFSTPDZOPJUKCHU JYFHMVQWMKRIRCUCEJVVJTDUYBRHHYIIMAJSTEKI XIOVDGOVTECBIVNQCGAURSBOSXFDHIWBCXEFDDYF KBIHGCICZJJDRIQQMIXUSKEWFVLMDJSYMJWHYAQV TSVEPAFIBHYLSSIHPBTKXRJWQBBRFQMPUYWZQJEM OGPCIOABBRZMDAALHSWHAGBUWPWMOEQKBNETHCVJ WSINGMBPNMRZYPDGOGBJLZNPOMXRWSEMNUFGJPSL XOIMKTPBTNFMGYJDDGQSPJDCTHRJXGEIACAUMTAF CDHKYICVDVOUHRGYVGFWHRAIZAWFLBIRHKPOHAEM ULTNZKHUOMOBGNWHPUZJZWOFFFWJPBGQMKGNVRDU WSEQAISDTOUVLZSYSJXUPIMIWDDMOXSUWHXIFWYT PZHMDBPHBJNKPTWWQTDDJJOSVLCHPCYMXNCJOKHJ UVKKLURIXZJNFGMWUTRJCXKQXUJROJBIVFYRACMK QQDWBZZQAMHCVDDXYIWKBCAWUSKFCLYLWACPISOU YMEMZHSSOOPVIOPJGARLVSBSKXZMIWNTRZYGFMAK UWWFUWARITSSTIZGCNCETZXBTSSBEHZXWFNASHWR TKXRJJUOZTVTZEABGKPC
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HSXBDBIQUXHSBYDJOWUGNRILBXAGCWVXISISLCNQ EJAUDHGLVHZYICAOXFWCOVPEUQPYAOIGZODCEAFJ OPUQCFXENCRWUXWGZISUQBAUQWHMRSUDLPIJBAHO FUEBOLJTHMQZIXFQYEPXAWMMJHCGRQKRCVUODNGC TQXLAWCMGMTDUJILXQKTCVOFDAHZOSZPSZECRTRU BJILGZTAHUZZSBDYLPOYLNCTZUXEUUSJKUAVOQMW KKNLSHJEVKZBZYJCHHGREMPRRJMCQCZWALQKANJL JUCLMLWBHHWRTPFGZCQUOJOWOSGRMIWTIJAPPZDF ZWRSJJFTJTFDBDQGFLAPHMUTOTGZGJQKALGGRGBH WPBRVBWVUXMPJRJLJGCYPMDZYUEYOVOKNFTEDOQN KSQZRIUYUCLRFXAAOQGZILSJYUFAFMDWVWGYTMYQ RIXCKGMTTECKFXUNARIGTSPUBRGAWWTQCREXZWKH MKJHCEIIPOSNHKMHCYPAPBOPOMZNOHBTWNFSQGPP LKLOVCCNFNIXCOJLRLDDUNOLIMUESZYNOGUZWCAA HDBNVUIPYFPRAQUXESQMEIJLSNVLZFNQNSJVWWEV MPUOMSCVYLDMPGOZGTZAVOLYZHZLHCZLCDYNZJCF XWIYOTAUPDQFUXSAHTUJQLCWZMXHMPULXNNOIXMF KKBZKXSMHNNQYIFPRCDIOCNUDPJINQKIYTLRKWFO OBRDLCULKCDESIRPSOMGOHUNHHMSLUUOTUYBILHO SAIRIUHAETLQGWPVEXCSLKSZWDUSRUJUJWWZBKPQ JGAWCUTKFIKIITJWGNBZGTLPDXGZIRARCVHNZLCS LQDKGBKIQYPUQBGBHGYEWWWDMCLCLZAFZKWLJOSW ORVBBARSRFMIQQDIQSJQEPGZWOKHPJPTJBBUCQKJ JTOMFFUVUWPXUEMZJKZMBEZCRIUCVYVKUERBXDGH SINTAHJVADCKUSTSIAMQIMOOBFAVGYOHEWJSGLZI NNDRZDUAKUELNLWJWRWOSDCTFPVYFKGHKOZJPZAF LNYODZBURYUQZCWZCZPFWFXRUVULKIHWURDYLMLQ RQGNNUPENJPCRXAPVQVEULFSIDMMVBLEQPQUCYLA XSTXMXDGRUOIVRHOAVPKOFEHVLQCWTAUHXTXLQSB DNGAXXCRJTUBFDCZBJFSLOJBCKGXTQKPDISIQQYE WOIKVTFFKPDMBMARLUQANDUYCILRFMKZMKBZKXDW ZJXFUNQRLPVZBYVYVOUPOYYOEKSILGRXLPSJUHEW EVGHOXPTFIGLECXFTJMCOUYUIPQMVODVVVYEWQYA SHNANEGZUFCCKWIBUJXBBICAPACNFTBJFPWMWFSJ SEPPPRFSFKLIUIDMZFUQBWMZQMXGGKCRBAPOFKMQ FHFPWVFFBJZMULBYZHPQEZZPCIHNIKVMNVSOSZYP FQEASACPARLDWTFNOVQSVKZJPHRNTHUTPFPMOXAF IVWXZBRPDQVRJDTAUMPHMMHMUZUXLDODZTGEIIFI QJBQXQUQPLHJMRTOFFPIXOSZGSGZNXHMHQLDSLKY PFYBCENIFGLEJRAMKDFXEGSDSTMQAMSZCRJYYXIU TJZECPUAFWUKHKCGYWIAPLRNXXGPRQCEJYUJMURG JXEUOHFZWPEZRSKNSKKXCJCAUKCYPQZAFLJGCRJU RUOSHJZJKIXYDVADWJALLCWUTLENRYODNEGXHYVT URWVNTUGYZGWYSFELONLLLCCCKHRRKLTOFTQQIYL VKLRJCWPCRVJWVJLGRSYXLZNYRMPVABFEJOOFITV BEMSHMTJFVUBZILFUYGEEUDSFEXLOVJWGEEGXDZG ZCGWDSHDHGMBEOYQQULTKYKTIOZINBLOZIACPHYY CKJJDOZLTCFVJLZZVDEY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DLPZJMLSEBQLLEQXECQKOTQEXPUSCEXBAOSMKDXF CBWFNXHCOGFFIEDIPFKUGAEGWQPPLRIUTILDJSHN DLVAAUPKYMYPSLYGTPWJGDJMCRCEDXAOWZPIBQSL QFFHPOLPMBMRHQSQNVNPIBRINOLPUYEBZORNKIDL QHSXSPOQHMXLDTUYAAGCRNQTQRWVZTLXIIWTUHDQ ULARHNXTVQISCFZBEVQHPHGRXGMUTQEKDPNDKWAS EHLBNCYKXNRGEMJDMYLLYNQRJZYFNARFOPBTYVSU IXHCHIHOODOMGJWDXNKHDPCKPGAXWXEVNAOCJMBV FLCIDJUJZJPZNJTFLXYGEQHRPBUYHUGZEALPAVAS VJDPOALLAUBXWKBDYLQVSSADVFBIGOZIJWIAIDOZ XNDZXPZBEVKYLYPSCIPPCEZJDNVFRHADSMHXWUQM NAZPQTKBXZBGTPCXEQTKZMKWYTFDWVQXBQOKVRUK IJSIIYPUCIRWUYYEDSSJASLFLYHKVNDAYNFTXEUK KXHYYDTGOISXFKPTGKOAYPMWAENAXTDRAEJTABFZ XDQTWRTPMMMHEJQSNAZNLMQLLBCUMJLEUQNAZMPH ZBMPQJQWXBDENDPINZIQWIDISHPEPLNZSIHBXUHZ IWTBMYNWQJBMJGARZQECTDRFCZHSEVSUCAGDATOA CFIQZVYTPLECFFDTODFTFRFUJINNJLNUVDHDIWVH QYZVRLQXRVLEYJQVHUKGPMRFQTWRLUPJMEYPIQFZ SAKGFIXNAAQBJIPGUIGJRDPEYGAJVXJBDZRNZHRS OPCHPXYEAOJSQBVNJSNKPCHNIWHFDLDVOSGTAMTI RUDQOBMZENAQIYLGVMJXRFQSZKCYBZHHCUXWANCV GVOTEEXABSFWQSPCREZEMQGQTISRVKKJEMMXOCEU RBDYMUBBZTEVPRSQULQBJKTOVXGDPMPKNHUMMIBV ABMFWWISYONRZSCEOCULUYTRMLKWHKGFNXSKBIUG JFWCPTXBTJNRYELQMNTIAGUQQQULEDXNBSHJILHB MJLBVQCMAASZKIIKBACCFRRLCFEROOLDZIYNNVUC PRMYJMKUXPQLZFFKESCWYXRMZJOWBOKVTCUFNBVW UAHXXIUJUAZARDKAEBKALGUNBCCGXHVFBICRZDLY DLTARSENSHYSIHDLZZUTMXVSDCRZAPKWHZUAVMGJ WKLSGQQAXWMOWIDEUDTCPIPCBFGXDPODYPHDEYHJ ZADBNYWBZQUTKNAFRPSOVQWVQXVTKYSHEKZVZRYV ZSMFQNBWQDWPQMRKYQQWWKNEPHFZMHGBZHHLTTVX EQBUGTGOCXCLQIBYXNOZLDAJEEXZJNFWNEJJBVMV UVNKPWCGYBLBQSWAFPGAOFCMILZDYLRCWFXCMHOH QXFLHXVZWGBPSXFZEWKTGIGHNQRHCCPLAJBGGJHC UORYCNNANFPXXWDXDLEXGFZOLFEPGCQZQAJMXODC HBXIUMILSRKBOWVVJUCFAMVZJSJPBEVBCRQXALLG HKWNHHIACFJPTZYRXPKTYYCGNOWWJWANMYVZKXSK IXWTJGMLNIUCSOTMNLQDLRSTFNBJQTRJAERMAYAW AOAVCRDJFSAYKCNFDFKAODKEESYUQQRXLKWGRZIS EFNBBVZAFTRETCQTAZCUJKIONNZABQIZTFWVJTLQ WOPXDVGXRAKMQTRCGZSBGCBMLWPLKHEGEDUQWPNI XMICCIDHXIVLZVOQBRLOXPMFRAGBEAPXWUYBOUGZ APURNNXVEYBZMYKOEBLPTQVEKNPEZDVXXPJAROOF GXOKOZTDENVQXBDVURZISCGRWONQDCLDXUSWPQSC ROGQSVGTMREALEHUDMDGQBEYIGOGMNVFBTFZJFIL KIYQRYYIMJWSQEBYYMBX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OSBARWCKVLLFDRUWSZJBHHJGTZBXRTEFJUUXTBPK TELYVMEGRIAFUEGBAVJAAOEVGAMUYVXVBMSJBEGZ ITODYQOCFGOGKKKUIBMDXMELNKKQIZLOEKLLLLTY ZYQIIOEKLJKSUKVXWUATXFUYYOHPEKFBSRCRREXJ DUVPKWLXPJBTWEEIEIXQCRBVWOYBATUBIMWFUDRY ZTTHECLBJEWXPNBJGRWPWMGFMINOZQOUGEFRMSJU OCQPZCTGUMQUADNILRNIDZTHXDILDEWDTEFRYCSR WQBSAQRUZCWQOZDWGRKGOGHOQGQNREJUZHNJURFV UDQXMKIZYCTBPVHHICIEHOUIINAKUPQCOFMAZOMQ EDSUHJIEJJIXEBKKPDXJFPZUIONTVEJTIGFJPTYA FWYBBGULWQIIWUUUEAWBTSCSMHHWBAHNBIKAJTCE PDTIEUJKHTKLTBMJCFGGQAXDKEZPKZWWIHGIUGKP YYETNNVCFVRWXZGIKVFCMQCYXEQKMGLZGCODTQPU MOWUWTWPDKFZEXFXIZZOABQSJVYYECYMISVCOHWS FVBBQIDBKGGEHQSNZDHWWYYCAFJVZAVPZSPLIOHI PEATFXDEGPIZIIJYHLTKKPVPRIHBYDRNYSZNZDOV SHFGYHAHKVVQCIYCDGMOJUORFFRHMQZARUUOOAIH JLPVBKETRULNTQXGAZQPIKBOQRAHQZOMVQSHBODV BHBSVZKGRWSJBBWGMKUYUGKIOHVSIMGIUMOBNKUV MQNMYHTRKLVCYBUZCNHAXOOQBGBZXJPLGTTKDRAJ UHSOABOHPAGKXDOYSMIQQKTCJYCFWZECRVROOWCE RIGUPHYJVFHMUHSAUUFRXUUFIFDQHBTWYCIKKUFJ RBGKLUDYHJKOHMBOTBTKUFDGLGYAKNDJIGFLSOQQ SVWUBPVQCAPQPLLJKEFTBQGGOFLFTEIRLXZBZNET NMXPYMJVQUURVGCTOSBSRTKNYDSIUHNZZPHSVURG NJKQMCGDQPDGGZQQFZZCAEEXQROLMQQQKSFAZZFM DCIYLBSBEWWQBPENRRYLZKCAYLEDVSTRXTXHPGPG BCPAAAHOOVVKKTYBNVASTPUBESCGDFTQUSXQKDEF NCGDVYEPLGPUDEVNSZROBLFKCMFWQUDXQMIODOSW HTTYXRTCCEPQETYUEPOEZDDLQSPHYSIAGMZZAWBX NIEYXNPZADUZJLWMXSBQXDZMLJXHSADFZJJXPTRC YPFSZIPCJIYATKWJKDJRDOTLNZTWXZKNMPEHKGSI DCVWBAGYANLWMUTNNNBGMXQUQBBVWSXTJECPBJMS LYXHTCDGBXWLWQMNLAEICLIQUKVXRXOULHEKGABX RFBUEMYVZVSIFEGOLGEKOWFXOZPWLRXOAGUWCFTO VXAPGAQRPWJUPZXANNQLQYXIAWZWZRKIBODKIYKV YSTOLBPCGGJJCDVZIXKYXQTLYXMGEFQGTEKICZFI ELKXWBMDSPATWUEUSGIUWNCUYGBUOSIGIGPQTOWP SIAFHAUWKQXWGVYQWVLRKWWUCLTCIWVLAZPIRICJ SGMPGOZENIQZFXBGZDJIXMRVTAAVSFPWICECZEBM NVGIZUVXAJVIUIUYZTSKKLOJKPOHFYJZFSLPYQJI KSAVTHQIFSWAVAUGTFGGTBUCIRTWOCOHMKQZDZTI VYOVGBESEOCBRIJBIICXPQCPOMIEGRCFYQRCXZVV WAWLOSEVVOARGCVWLRUNILIRJYVWDZPKRKWBWWJQ ALVHUCIQEVMPKATJDAXYTEHELQMLVMCYKVMRDMPZ VHIJPSBAVAPBASWWFGIBJUPLDHULIHZSFKADIFWJ DKKREWHXXDZWJEBNSTTLXYRNTPWUTHZIIXOQTGHR RGNYTKBWALRZIYUAECBR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NAUDPYBKSVDLRIOVSDQLDUTMBEJAUJGCVENALRXN XMYEAODKCASORKSTOSBMZHAEGNURUPXWVWDYFRFD SOTCLEUPABDWMGDDNMZZIEFXTIQQQOVKIVSNZFIC PBPSQUJQESBJAEAIHPMNVFRRPJRIRNGQOWOCLATV TOTUVCJAJUPDIEITHPVTSCJFHPJRQMQTBFEEBLEA ZFHHTFTTLJQXPEBIHBSLVDESQPOWCGTXKPHPOUSY XJZFZGEWSTOUOVBTKBRPLKNTLQOKRLIHBAXYQIKI QSHUQEPTPBXELULGVOZJFMMKAZGKFBHUIZHVGPME OWHLWXNMTENBKZOFMJAOPLIKNLPGJTYBDFHIJYYS QNAKMHRHSRUZJPNTGDMBWUVDLJJSVVVFVHKHBNGL IVJRJRUDEKMCEDTAJSVRENEDAMOZVTKBOXGAEWND VYWMZEAXQPAGQGXEDNLWIELJALRIXDWQQQVJJJCK TQPWZNXNHIGLEMFSTWGLAYWIOSMWTTESPYGHIXQX MEOCKGCVFDTGDUCPHFAVVJVLUCQKMMEUWISTYXSX XUSZLVGJKZOGYMNLTECUNFWLXZXVFWJJLWEXSEXJ HFWLQFBTWOXUGQYZALQJCIYVXRQBFKJYWWBQUMNL NXFMUFIXISPJZGNITEGSHZXEOGFROCBUIOZQSBCT SAMCXNFIZGELRZGZWDCAHKYAMBTCUDUUFKGYLSFH IDALLXSPNQGSMYWTKMSOOYSDPVSMDXSJFXJWAJWO OLVBNDHGMTPJGFJCQHDZSFFULOMSVAYCYWTQMSJL JNSYBAFIGFVAXNCLSDEMJIXOGYTKJQNYXMHSUEAQ GBDRQGPPYIOJSXBSGVOVICJHJQPAPGSRFDANLKNT IIAGMIPNWEVKXIZUQACEIGPSFHKFYHPCFSHDHCRP KURBACPNMNKURJIIVYVBGHSUXAELZVWKNNQHOPWV WKWIYYBQVGUZIZZKILAAYDPYNKGMLXPFODQKRWXH JARITEJLKCLNDMAAEFDIFRJIVYWTIAFKUOCUDYGW TFYXIWIVBEWOOOWHDHVVYBEJLHLBTKCFQMVTOKYE YEPMRUVBBSIFRPEWKFVLNAVOWUQOJBWLJRJURBMU ESGRMNZDWMAJBETBRWJRETGDDMNJUMKMXLASHBZT XFPQAYFSTVADWAWADZCYGCSCWZJUXVTUGHTSLOQJ IPDVAENNVTKLYPQDABJWUASMWAOJMAHXQBUNOGFK OEMUMRCIMNMZIFSHPXCCOLCWSUZYCAQQFLWZPVWB NLLKJHKLWCBFIFXARLHXZFADXITYDZZMULHTHEFH DCNTKHKRSYTHSBNGGYVMDGMPWKPKHPDLCBMMKNFC VVSVCLABDXJWDECOPOIQERPWDVGPPIUKSFWWMJLO DUMOHJDWUTUSHQZHKCFEFYQWNSNZGMUERNRTPKPI JVITBTKMUXANFFZAKDJBYROQNREEGWUGVEOLYJQJ CPQRYUGUJCXQHILEZPCHFPQXIKZGAXKLBOHLSZSW XEPPVUXJDRUASTOPOUQMZNSEHEDXEGHFGRSRDDPK ACRWIGBCGDELLNGVFORPBLCRNOIPBDCSZERDCVDM LLKXDFRFGVCJNXAMOIUOZOCPEFZAJONFBMQQSOFA KLAMHHJFQPHLJQMGPIHMWKSPKPUXPFIPTCHMBNFX AGZCJBYYXHVCUGXSJWNTWWDQNTEEMSUKXNHLXFUA ELLCMFGQAOCQRHLUQZEDYCRTJCTZACNQPAOETIES HTYPGUCJLILKWPIXSYOKOBBPTQJJCHPPGOVMCRXA BIWVRTYROCEYGTJIFPQWIGZKQAXJBFDFBMHVBVOJ NYDWNLVTHKAEXTQMFWKPPRJFORIZVYYEPULKVYCD GUXNJNOJUNSGSFXRNISI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PPKJTOOTQMTLRJYUESJMCBYWJHSGXJEJKIYFDJTD WZTRRAMLRYLRMTNRZZGANKNYAARELIXWOOFVFRXH PIKSITQURKVDFHPNSQIITEQYTUVDSHKREUVFUIWJ ZZJWGZCVAPMUOBYNCJMSGYVQEVOMJUEERAJGUNJQ UNBALIZULJLTXWUXQBVSWGCHXWIEMVFKRSSJIPCI GVKLJMMRXHVSTZSINFENNOZGQCPIPOQTCXHZTBUX YBXJJBPTRFNYEEUWDIDWZAQFOAPRRFNUHWKJHQCO CGKOVQLTWSRPXDHCWHSHJZFGISAJRBLQIEIQVNJD GKBXVRLOSRJPYTLDUISKNQBWPXBTRYSTABNVICFA RPHTRVPFLHCDCHQNXQESFBHXLKYZNDRRGRAYAXID GRHBIBXFWRNWHDRTWUSGDUKOEUZIDJPXGUQMDDTF YNMQBYVRRWJQZQWQUCYQQAKXLCMPIGUKUXLTNBYL ETDMQVWJNMTBMVHETHZYAGBEMDFBAUJFMVWNPTTY CUYHAAFKUPQJRIXSNTMOKYJLBQAEVHGIGJMEIIMO NUFSGFUGPLGQRHJHMTWSDZYCMIHWUVCEUHPAMMGL UFEIYCRMQHMOKAAYKMLFOZGIERXFKKEBCGLZOUJO CAHHZIGCGFVZDAXIMHWCIETAVJCZNNCESIXBHJHX OKIMLXYTZUYJAVRBALYZWDFHRILCQWZZRGXWVEHL QGKUSQGIITLQCXUPNBAKYKCJRZLYDWPZYDUSWPJI ZRDMYRSEGAAYHYTTAABMQITQQACUYKUCBUZPHYWZ PIVEUMYZJINDRIJTRAVOIORPYDKKQBSIDTXHCNPK CLGAGFONZABKZMOCVEMHFQMKVKZZNEWNZNDHMSHK DXHIVYSHKEKWVSGICKCFSAXNXOKIWGTHJAYJPUVU FXAHFKMWTHVHNUBVJDNERKOYYIYMPBYXOTIUSPZR RBETKVDCVZDSSXKKHNSKZFMNEZXQVLSUMFFZMBIV ADXUYHTGRJUBKRRADJOBQMGGXPJDLMOTLVBLLGIL HAACIYDTRUFUYIJVQPHAAWQANARUYEOYEVIKDWJV XCFKILYAUCROXGRJAVIPEBBFGODGVNJANOOUULGL OYCHPJVTVQTLOJEQGRBRRPVCUBQNBOFWUDIYCZEJ CDVSEWDAJAVASHAGBFZVIICLFHVTNRDGJSSDTYDJ YNYGOSHPARJVEEWGQIQDYURLDPUKONCHEEQOJUKN HSIXMEEJJUKTGURSUATJOEIWJEHFCJTTDANRJPGO XDNKRXTFAUTWYIIVWISDZYFIHLMISLUDGOPTXSIV WXKMOSRMOIBBAXHDZJFMVMQCUORQPSPZSHROTTRP QLJYWLSOYPTTIVOPRFYFFEZDAARNHSLYFAKWNXBC WFDWAFPOYLXZHEKEHHYVMATCFUZZEYWHEUKPGSYK WRHHWLZSTMOZVPKNNHSSGKVXGDXZLNOZSALPCVIE HNSLMSBEQKTULZITSNTNMVYALBPCCSVSNACWOXYX VGEYTOESSHSUSBYORWAXXBVKAGIWJKJNBJIVTAVM BMJXPPVKNNYRUHXICWKJRGIQZOCCWVSULZOAJHZS MPXGSXIQJOXOEOYJYEUACPQLMXXMXDEGUUICIYUF FOUGGDDGNPXZNOPVFBASCWPYRAQNFPMVZRMQOKTU QLBXDAPLCXLQKDVXYRMVUGAZKTKVFOFYUZTCIKVF OVCDBEMQHSXHBDQSOZZWMWTPPIFXGPAYGINTTRAA NLOMVWVJSXGAACUGLEUKJOTTBHBNQBUUREEBQNSG BOCSTMOHWUPDIOJQTIVLOQYXUIPOBZVHUCKHTSEY WNSDZHUKFNCOTSPSTFHCBECPWMQQKSSCAWFECSPV GSDLIVOZMVRUWBNTYCVX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WZKGZMMRONDSMRLRHVQPNRFDBPLFBBDDLHBVOOIP ZYTMFDTIEYEWTXBLDCBYFURMARMITUTSANABNVAR ZNLKISBXZDVVFANLLQEWPKRSIGTRKAJDANBPKLWI LLMDFGWMALDLIDOOTRFZURKTVZKVZHSHAXBELOMK EZTBMVIWZTCKGNVTAYMPPEIOCACKQZBDYYXTJNBQ NYGWJAGMLALDZEVZLGIGOULQPNDQCYGWTAGNDGBE JEAHIHANRPTCDSBCLGFZXNUIYQCHOIZPGFFMKMTU MYHZLCCVRDACMYHYEINCPGTFFUAJDHLJBVFZUIWA XDBYLCBSHREAAJWUVABOHGRRNDFWHQRPFLOVCCRJ RUCHKVWXMPWYGEKJZPHRKZDNAWOUHYBBLUUONUSN JPIELLUXMNKJLQNANAHGMBMFJAHLCXCVDSSFHVNS BIWKSXNSVQWVLRKPDWIPIUCSQJYPQQQYEENLYKGD LFTFFQCCBRFPCYSVHIUSFXJEXLGLONVPGGWDKDAP ORUMFKMNIOSSKFCXLYXRMEEJNGXGGVOAKYXOMGSH WQZXIXQRAHSCQJBKHCQYNBJJVGVJKQQWNMWMWRUL SWUOUESITXYEUDWAPOKWCHBRXXJZJXYJIOXXHPYM WYPGALMCUUIXWNVEXCOCBBLGFQCRUHKJKWVWFARW ECLNPXEFDFUVQJPDNTZDSOIGELLPYPKQNRJVTXVT EBBCAFCCXJRTNXQDWKFAABUICOGCLUBARQYMIOWZ FIXLJTVVDRJJJBNHEPEWBZUYUEBOHGIKBOGBCOJM YOXDMOTCYPEMVIXXIPTOLPMDRROKLJFXAZMNYVHY TXTDDGYXLWKMDOPDJEQWPWYHTVTNTPKDXPIJLAPG HBVSZUDZKCXFILMGMQJDOMROXRKOPLQMOCVMQUSV KQQSHFFEFVQZCFOXAMFCSIYTTYNITPLHBNSMCZVA ZKMMBCXVUKCHWUXZFUTWFSCQEKDNYLQRFRIDMMAZ HPRCRNZRGWEWHWABWZRNLNOLXFSGKRTEPPBYZEEP QKMWBYBMOIEFJQJUBPYGKHRKFTFRVVHBIUKVITHS LUHJCWPORSGOGEITCYYIGHZUFBEHBONTNBPNQYPI XIPVVSYSAJYVLHZSPATHIYPXMPMDRBRLRLNAXFII JTYMDAXPIGXCSBOCAGQKRVTSWHBZZAYOEDIHVFHS TRAQGXXORZQDAXXMPDFPXWNELOYPJWAFXBJTGRGA CVPXVSQCMSJPDTJIFMDJCGMHCOXRRSOVLPMRAASU QCHDXIKWERMUYJIKHDLKXMJBVVRBCJTMKIMUCZPA EYEZXOMWXSTVTORCDXKMCYPXBWQUDRSXFIPSIMHQ JQQKDYJSBGYLRLMSWFWNWZVAYPHHDYBSVFXYBNOH YTPJBKVYATEAGBQBVKTFSUJNMBWBLBEDLYTEXEEQ WMETESWUAGVHMSYPOWJXXDAKBAGUIZTYPBGSPYND TSSPQMVVJQKLRYFMELSWUVITUKVBSKZRPVGGTPDR QWQOYNXVFMCSNDKUWNLHJWZUOVNPVJQZGCUICIPS ZCWIZQWQEQZTXUHDSAMTPPCCMKWVEWDNLTNRMYCF LSEHGIACCJBEYTYERTZGWNOWIKLKMSGXUWOAETMC YTEURKWCVCWTQWPBLNCHAEREHIFEMSKLBTSYFCTL XWAZKLITPQUICUWWLMVXZDQVJTZQOELEQYUCLRIF CKCXIOWVUNVPJDFHDOGGGVUOJXBSWMAVASMXIRXA QJFQPLVETTRDBBCUSDNEAVRNDDIFHWYUBTVYIGZS BWWTICDHDXXNTFYTQJVYNTDGMHDJSWHVQXQHONJB JGXQKRNOTNHOXGHRYYCIOIJSSYNKNAAFECHEPRMB IYMHQKKOHFWWTDWOTGVI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MBPHFMEKYFUDMDGADJIBAHNQTOMDEGVOTKTSOBZG NWECNXKVRRNMANEGFQNMKCDZNTHWMYVNDLFIGLXI SDAMEEWBMPFAVQKOOBLQDWVDKGFEZJFPJZONZCHH KOKMWWQDJNKLQLFAFECAEFOJWMQIWDGQPCYTMVIL GFZQEBISIZTIRXTWVVOQWNTNJUSWTNPNLHPMKYQC FQJOISTGSZJHNWQNTJDNGRBVAOGUBYMCYAQBOMPX JJXQYMHFIUEQAUQYBTFLNVJHTICHWUDVEAEKZOPR VCCXBZTQNWFPPDQTOBQGDBTGLVEFIBZHCKOBZTES FYVHADPJJIWIQZMXIGKWMCGGISDPCFCZGLKGTRQK ISEJTJMGTRDAHJWYUVJGNJSNARTNEHHRAVTBSHOX KFKZFMKIBOJHLUDFNWJLKNJGIZBJZXKIXCQGWELX KBFYBEKHOZBFZLMRDGHAHBZTXWOAKMYFTHLWGUJW MQLGXCUTFVWHAJJFWJUQUZGPYUXVENOFJQMJCICY JFYMYNSOAGYKXHSQORRBFGSZZBIASNOADLWIMRDY UDOXDBFMXWKMGWRJABZSGBBLIOBIMOIRSRJFAGGD GRYGSHTKPSCLZEPRYDUOKMUJHCWVYDOZWPZHOSGS SAICMRCLJRVIQNEBCHCVYIXGAASJOCXKLBPGTORM NGXPYFPBOKXMOEHVOOQXHKJPBHAETHMEAGQCJTVT JDMDBMJOGSTRRAYUTKYYCLHZXZSLUVOULPUCAJDS JNOUTMRAGUWZBRBIOGCUGFXVGMFDOYBZURWBZFKH BTBFBWKDZUCLAEVHENSZORQFWQNYJBHOLSSJFJIC LLWPJWCLZMGRXJVZWTBANQAVLGROSLCJLJYEBFFW BHXWSHVFMFJNMVORVZJXUHPZUCCCEGXRHXRXEAUY BJUJFEKFRITKGTLDYOXRUALQNILCONVHOGWAXPTU FMTINMRCQGBJHECNFUOFZKOZFIFOCGJVGQABTSBQ CMARKHCQSBVNSYGZUQBWDDBUSMBRMYUOEOTRQOQH FASVBJKBGWPSIMKUIRGDMKSXHCKMVVCGGSNEYYRP NWUJKAOBGUYFULRDGBZEULSCQAPBNYOIJQUMEKXU UEJNALIWJKKMTIOWYYWVLUVJVWBPPCQSNNIVAZMF HJEEQFMAFGGDROHWDGVBIPHKDYWWLGUVNUPNVTBJ XUEESSGHWUVSAUYMRYLZVAEPTMMDMUCLEVAZZWDK QHMAJLUGMJECXXIMNYPAFHFINEFAYCSXUHSTEPTN VJUQXSCEAUKXQIPJMZMFLCJQSTKDHWAVHAQWPIUQ TNEZVGSPOBHDSHOLEKTETFYKQLIPRFOVVORVRAGL MRLVMUWJEFRJBFQNEYNZPHKMGFHTMKNBZKXCRMRZ LOJTQSIVWRABSENIWBPDCNOXHFGDJWESUBYHCIBG AVTWOGTOJNLPRRNLOZDRCPHUGQSJUNPMGSDCWOYD GSBMMRBUWNQZFLWABQJJBJICCSZCIACKSPTSCSJU GMMSPRMXJZGQSNVBPTEZWBMAYLJDFUFLMWTSNDUR CUQRWYOGKGWSNGPLMDTLBERTOLRAWMKQTHSGUBZA OGZRADFOVTUTZEBTSYHUKIKNYYLBTBHUQOHGQTGK UYAZVLNSMQSWQLTAOVSHNNWRGCARKOSNQJXGKDZA HELBEAVHCZDWIQCLCGLYFOSYILSTMRNCSUEROYAP XGXSZWLCKXCXYBBCTJZKFHZXNYOGBQLOCMSBJWPW FMLZMTKWBTNRHBEMLEQRGJFQLKPGMYREXSCCSRBF RYLPJRCQDTIZBMVSLDVDOLDKYKISXPXIUOPVMEVW GQLOBGBALKKIKUBXIEJOYTVTDDQOTLVAOSTTBWMY AOVKXLCZKKFUVSGFUPKW
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OPCLMDQNAQPOGPAGURSDIFXPCTWMGTKBDZZNNVNT XJTVHKIZUWDEFHFZMOYGIZTXBNRGXOWHQJLDRUUW ATPALZHWPNVDQQXXIPFKNXULFZBOMLPSLKBIVMFE TNKUYBHHFZAORDPAARXIFTXHIAFTCOFHYKKZNTHU VCHOBGPDXUMMQVJHEUACQQZJAGBEDFBKRXXIRSCY BETQZUSRIEECCFUTKZLFKMQPPQDLHBBZEKRQPVVH BFIWSALDQHRNOLAWJNMHLXHPQTQCRAXQPUEEHSLT FJMAERYNAAKAVHGIEDBMMQBTMXKBVXBFOPCTUFRL KDMGZVNXQRAJCLMVKGLZUEGIWHBZFMXFSERQTWTF QYSSSCOGRMGBQYHSKTNHCQNIJOAUPKCIGOOAQMAW JJSSGUPBHPDFMUEPAPEXAINBSBHUHSOCIXYGPLQQ PQQIBUYPYFPGAJEDPWKKXNXFIARDTGSTMKRDOUVD HFYKIDTIKFMOCRJGNIIVVPSCCLFJYNPWSZWLHELI GVOGDTFSFDDXIPMDQIAGFSQZZTQPSADINYNPFIFD MZGHYNXPGUSWOWRJJBBIXVUMUSCEDOHQLPCWTUPB LFJAQUFPIKQUSMHPWIZPIEPHUAHBEPFOAWYMPJXS AYSDURRIHPUJQJWADGQQXXUVWDYCLLHNLFRKCKVV FZERPROIJIBMTOFTUQWRHCBGEATIITNKUTIOVEHR IFJFXAJSCPWKVPQRYHIFZBMIAGFDOLJBPIWNDPKZ KBRGUWAVUZDEZWLRFCYWHNYFYRQMESFKZKSZWHTA OTDLFLKVGHZACOSBSCVAVXDKAYUNPDLKIIUEPCTK APFGZRDOGEKOJMWTAXDIKQCXIWYHIDFUJDJLCLRX NLACLOZVXDDVCMCIMOYFQMSDUAMFVVXXWUMVYRND USWKDCUCSMIMGMWYHDOHJLQCUYCGPYMZTAILMKST KMEQYYFFPMEYATBQHXGWFDRHZKKFAIJDNRKKSJCF KITRORHKLDMWGASABKKYRVDIQZZWBEWELNBKZEZA ROZXTRIIHFSXEBPOYLQXOXSYURPGBCTBKNRQKIAZ XRWOJUTEUPFPWORKHKKWKGURVWRLSDOQGHYYTXKU IGZAPZXGVMUHWYBMWAMZMZPBWIEFMVOYDTBCQERY YWZTMEMFVTCMATAIETNFGGGAAUYKLLAXRPALXNGJ IELNBCOVSIVAMFFGVVPKJHSVTRZTEHAAEFMNSMNA ZVDJQCOCIISMFZEWEQMZSHNWANNOQJWIBSKAYFKB YZQUQIRFAMXJHXQBMLTXKBZZHOTZAMYUWIDJMHJH YGHACLDLTOLAIGQIVPMQUMHRMMZKBJSLQTRKFPDR KOZYWRFPLBFUPFNNLOUHUGKYNNJYDQIQLQXBPYWV TLUARGGOTHCVRGLDAVOJIQPHBKQNCKXAHBDQHIEB MOQWBYDENIOHMTLFAXMXZQIIREPYJTMEWWEHLLIJ NYAVIXKORQEOWKKFJPSHFPGNJLHOTNLYWTQXOSVZ AQLABSZTRWMTRYKKFZWIGVXDHSZZZWIKZQWJOGHL TNHZUYRJEBRVBWZYUVVITAXDQMZJVMIGKJASJLCJ XFXEAJULQEFIZEIYSZCUJSPECKSRUHHGKMAAPJKP DNYZWADXJJWCDRMEEWQBVOUDOJNLRUFSQSBGIGOC IEHZGJSWJUYWYHWOZHFATYEZVZNYJSZYPEXARGCL KWMTNTANDCSZFJMVJMTNFNGVXAMTWUXQGIZYXPYF LRSRYSTTHBESMJNOAQXNZGWOTQISVJEFFNBQXWRB PAXLIHRYORBPCNLCYPSUSYUQIEZNNGJITFXMGSUD DQNITNYGMSYYFSIAUOAEADHLYTKIBLCUVVXPGVIR ESAXJGFKULKIXVRAQOEM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KVZBGZZISTVTZLGPGETRKBFXDTYBQCDCNOQLHLMM XPXBGEMWJNAUADPLSJKHBZYZVWGXJVKEKJMBZEAW JJWQTIFRPOUFBMARPDVQXRTZOTZHRVGTHGOVGSRP GGBYMTHKQDMMLPPRVNXOXPKJQLHBVEQBPZQAZNJM YQVHDJXBBZSNOTQUFENUBRXHJSOKNMFWKZWRZBCD NCLCCFYUHYSWLCLCORIBHBVPOSGXBXNOLMLOUQZL OAHXSFPKLDOAGDRCGLIKMCYBYPTWWODSVQUTGCPC XWLGRPJTIYDGSPNPNCIEXDEYQARJBQCDAUMQAOQA BUNDPBKOBTKSMNPZVLRZKEXPICMLQSPXDXLXWZXZ EYGNFPSHWCGNPGPWKBWHWJAMIATHNWMMNIWJWEGC OTCABEDZFCRLDLEITWMOFJDWRAOCBGXYLBVXRCCE XFYNGPZSMNQGGNHKJVNKNNQVYXHOWKJFYFMLKSSP WTWILYPJIOKDFERHWDXMQBNSFKEGJPXTGOMLRQIC CCPVTKMXYWHRJRAMDPREOHAWEXNJAOOXSGCDRXSF DCGYWGZKSLDFJGULLOBQQDRRGCVVBWPXYZKWNNWK WVBFSFDIJGNWJYTLODQOZVGPEKLDIRQIYVBQMYKN FUUZIZYVSGHIYKVXKLSFZZBFSESLLBYGHBDTOIPQ UGJKWGZYMFUCOBBFFODSXLFHURPAJCMUTAJYHSJL HZSUISMYJBBGCTIORLRXZDDFIIYRJSOHWJHWESCR HWQQEPDXVOFRPCRNCYAPZWECXVUYIMEXQCEFQEMA UGUEPHAKWYXLXIJXCYJAAXMYYRJTMIXZMIRZHJIP MXSFPXSSNQDYTUXAQZQTXFSNRGSOLDLPUIBWRHLZ TZLBZSNQIURNGRFJYXFIFBOOOQZLARUPAQUASRCI BAJHTZKYPQXLUTJPYVUGAPNAJXJPEYXLTWGMKCSU UKQOFIAVTYFEQZJKSLUHPJRYIXUQMJAAVPPTCNAE FTLXBPNFSRFFODHLCYETSUDTMKVWUINTFUJHWCRZ SUHMQBJGHHNKJVRPNLRKTBGOTWFPJATPQBDAHSSH QZWPLTGYNNCRCTVXWALFVIQHJOOGLOKTCINCFFZT UCPGDZOHIVWGKMYSKTJHOBFYRVFZSFPUYBGRUPBT FWFUGQLBXBEUMBSXZYAQDPBKZFVMTHUJMIFJZPKE GLGZVPRBWHYHLGAUOXTAEFBJXFXKBSMLUDKABREX NBKUUIVPJZCKEOUBQBHMUEOAKAVWZZAKXYLGHPHN FMNETJDDGPZGJSMHROREZYTWAIJZREDCGYISMHNI MYBCPRZLOMERJRJDJGSWDQVGMDIULWRQBHOCYTNZ HGYADFZKHNRLJVWCYWPCZLYRVAWVMFDSEALAGVNT QOGJDLBCOQWNOZTRLEZACFFKNQDHNNTMWFEJYEHD HJKLLOAZNBLKERQDDABYKFFDUWJMDVLZTUVBZALZ VLGPOSXBZDOPOIZIOPKQQRDALPGCZPSSIQGUDAPX XZCSLPAQHOXRQXBEKAXFAWRWQRHXQCLKKWDQUZBE HIPKVCKWYVSRDWJJKVLBNQVASXEQHKBGHHVASHRI BPNJRZENACSELQJZKDKYPSXJHOEEGLLBIHZLAXHT USCGYJKGEMWYVEJQTUWHOQVHPNPDOPMUICUIRBOK RYUKBULZNMYNCBXBANDUBTXILWJDTFPRXCIJGIPD DSLOYLXFSIIPEBUBSJYESVXAOHZOFQUHHJFVCHKN NVGHVGUHOSZOQBKODJBGFZKGJDHTBGJYNPDXVEZX DBFEUUSBPZYKQFNDZPJJHJKVTVQQEGRTWKHNYKPK NMVJWUAASNMDETQBJKSFFAGWZSZUBXRKAPRTIYCF MPCVKPLLEETRKOPLNLYZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      XVYUSVKROSQXLOBDLBDVBDFLIIYBNDOBLALEFRUJ ZELPFMGSEFVIJZVACZNYLVLCMPWRTLWSQNXVBWSS QBCDEHPDTWGPNYOPHWCNWIBUEXOPLHDAOIZEACTR ZQJVCYUYJTWYXNPHBDYYPKDOJONYIMKVXYJGROXM IOAEFSTPLZAKSRBEPBPPKIJVDTERNOUTZXKQLZXY UDLNKKCUJZSBIESFMGXBKHVUJEKPGXAMXKMYQAJF ERNIXFGWGXBDJZWWVYLXVNTLHDGRLXDUNSBMNPWV AQOOCVVSGRXZKRFRPMEFSPIITBZFDIIKNYLPIPWG BOZKQBTOQWWHDGVLNZTJQHUCGAXITUPEIULKMJAP KIAZGGHKJDCXJZAQQYDIBBIIFQELBGMKWSBAQHAS GNBPJLOYXDIVSUIBRRRWJPCSWOWCFEQEMZIZDGHY PNUSTENWLOSOHJAPJFVTWILRRPSXQDWEVXQQEJJC IXCAXSKXGQPIUVKXOHOCQRUXQYEIXIOSFILFNQND VGGBTQZUXJKFZHXPEUDNKRSTXYLRSFBZBHTGIWQD ZQAQKXTMRINPMETAUZVLSHNMFDLAHKIUKQIDANJP TRBRYIWGEKATZPFBYWJTOCEIIVTIYLXZSUXDFIUL KVNCJJSOLXHKUCJPXTTWIQZNPRGJWIHZSBGWDEAI FXBMXSFLLXVIQRSOPWQQKNKIFSRITGOZTCWHSYJZ FXUJHRXBSMIHMYLHWDJNKZFOYBAGQCMIMMBKZTUS TCHDMFMZKADFGWZYMJPWQUJOIJDLTORPHIBQJEPI KHCEEJQKRHUTQXMGOJMTYMBRMRLWPAOBZXXZADWX YJUQTYWQEWVZZALFGIRVAUIPMZSVTUYXJBHDYVUR HCDMDSKLJWRPYZJPXXZZQCCVWRBBRLRKZOFJLHAI SRFLNIGTUZLJIHHCVEARNEFGVQCJTEGBYOJTDPFL IACIPKCVHNWRZRUJZHSMICGBAUMXCOVZBUUEBEPT OGHJBHHQDZTZDNCSNUGLNYOCVVWAJTXDEMDGYSQF SISAKQPEKZHXMYFSIHZCIPPHWXBVXMCBROHSKTXQ HDOEUVABYQGGCTTQPLWWZDUYNVXQUMESCRHQVIEP EZYUNUZBZXSCEAGQVFEITQIXMRBDREVDHZOBEQHA NSQCFZMOLIVWKZDTPUZFDWBIMFVXKLEGFHJGBBBC WJKDYAZPQCBAEEVILVHUYQMYVFCVGKAAORULPWBS DTNCGJFUNQYRUIZSLBAURVZSGPEFEJSMYIHVJUAW ZQAYYQIFUSEYPAKHMZIXVNRJVNBECXQZTFMCZSHC GGOBJNYMOGUPAQGJHYCLPNSQXMDQQNMIUSRPKKSX UUXXNWDFPBHYQJEYLXZIVINJGXGXYNBSGAFRLHAN ZXLSANHWKWVANNJZTRXURVOETLPXKFPCPCSKEQGS GGJTFHSSAGBWSMKBNPUEAMJHRYXPSOHXPZRYEPLD GIXWVNXZOCJGNIJVDCAYZCSBWSRYMEJWYFAEXGIH KOGDCLIUYWYPCQSYKXEJKBUZQXNMYDECLFBGTASR YUHCOURHIGSWRDSQJJWBRSJEMKUKMUYFEZUSOOND PZFNJLAGFZFUHCQHECVREALKIWBJVFIUAURCEBJH QGSYEEGMIIIOTXNTREKZRESCKFAEYJCOHUXUSAHZ UMLPUOGTVBSHDZZRBISGMAFTFXLOFMCNMTIJMIKD YBCBGMGRWKLRDMCUQYTSCMEOZALUVAUXOGZRURWF QXVISBJBEZABQQDOJRAYJBTPSTVUQHADHOMYFJXP YGUBOGIETFVGLWDVHGOUAOPWMBKGCYVQWUOPDATX VKNLQIKRSCSUHVZIQPYKVBWQIKHNDSWEAFJSCMCN SZEKTHQBCPYQESMTTCKY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KMKOPJYBHDBUIKDUQAKWNWSCUGNFMULWIFUCJUFU DQVFOFHOLNESSTROJHKUQLNSYVZVLFYUVITBAETM MCENUAKIJDXFZXYOBLIDJZCHNBLMHNHQIOXEEFLL NQZHFMCBNPDRFGFXVTRCBDYYKFBCZDHRVYHVEQCF CBDAEIIWTDZCWKCJXWLYWNGZMRQBSEMWVPIHNNFJ WVOQOENBHZFGFNUCRDDPYKPUBABJWJYWHCZVRPTD ZXLHXEGTEUHQGFENIRQQCLZBUYOZTXIXUUZSVRHO TUCBJWZDQTHENAJMNOBOGLICQFQBGEVLFQYJNUOS LOWHXNGDASNYVSSJCFLVKSTOHBSHVFWKSASRFGVZ KTACLMMJBHQUAXJQBGOQGVGQUXOSZRZPQCEOKCNI IUWTHRLPYBFZXBSAHDRNHMCQJFBPEIZSPVWYDDOL PFPXSSSDEWFYVUQSSFFEUIXGCFEKHGDKMZZHTHCA WLNWRMMLTGXWHLURRYRAVYMVRFQDPLMUMWFIILID YEMEBFMJPDEEVGCKTWDNTECHNRTFPYNEGYZSJYMP TYHACMDNMGOHSOSFVIQRUQSKFVMKJKVWETLVDHPS NTTNLZTLFFBDDPIMNUIEPHBAOXXZYMWJHMSDGLGU HZQPVCRUHXLBMZNALACRAQKBSEJEVHNFFTJNYJYJ ZCZRZWXBWNHKOBTPLENYKOTGAMTUZHTISKAZETCA XKILJNVHIUMQDBZPKHYCFGTIGQHFRHXGAJJHHDXY XFNBUURUMAPIOUVZIWDCHANKXTIOOORWONUGDFPT HFLFFWEZYIULIHAOQYPREMSCAVFEVAAHTECOZZCU DROOPWWOFJUQXQECYGJQUXBDLUYAFKJNBWNYFFXE KQGCCRMKMOYOFSZKYORKQRFVAHAFSFCYRYQYJBBU CYXKJJYNGSQEJNRNFAKNLWTQEQHXZOXXKHGCVTPM SIPLDEICRPDJCFOWFNDSFWPJFXWVUZSLIDCZOMHA QSFLGXLHWUGHITPYFBMZRZGVUJXZVWBVLMZEKFSD GIOXLLBGMNPFBETGPWIGRSEPDERQOZOCKRKSCQOP BLIZFHBHGIWAQANPHJXDJLWBOYVCDWOUEBBPVFJG EJTWIWGYOHNCNIGLUGWJYFZROCPQPUECQQLWRBNL AGHVSOTKVUEQRUDUYHAWPAJAAMKUODYHPSWHPHGP RCDOZIIIINTMPXWZOHAGPNROWEOCOVXPPXLKKOKU EMVWPFSTFZGLMCTWHQXOPJNPJKNGUNPHBHZLVFXG ZRMIAGGVQRQMYRJQETHQRGAXZQEGHILWSZUKVKPQ FZGHQRQWXHWQNMSERQOSAKIUTTHCTFRGYEFFNRYD DTOWPRIMXCKAHIGZKJYLRUJUEVTSBPHHSXFSEMDS ZIJPWLWKNBLSIIMAEQEGTXQYWZCPMLDUSTTJROQL ZZGFJOTIFAVVZUTDDSPJXAQRMPYXZUKQWSWTZHYV PLWMRFFVBHPHTQEDHEULQMVGPVSWOHYGMDYDVAVP ZHWBYIMKEFIKVKVGRIBZAHYZVQGKWRBIIUVDJWBD YTANOCJFUVRHJHOZOOEXFYAKCSIEMNNBCVZMQZAY APHTJVPOZVPKUPWNBRJXTTYUKPGJFPIIVWOTSYDP CLNHRLAXFDGNUFRTVUPVHQQQXOIIHWVCXHMCVAOU KDUKKVDLNULLXFNEWNMREIJAJRVIPZFJNTZZBRGI FGVXMQXJUZCTGQOKSQSCCPPWUVDXKHFIHACJJSYF FNNRTIHLLIVDBQBZJCRSIXICEKDPTVMJDNBDKEES CHUGAVAHBZTKKMYXXGZZDERWJMMTPPFGBQBNSFIQ CGLXFNPYFBGPQJSCDMNILCDWVPUGNLSZNGWNTYZX IODDLVDKSYXORMFCAYPQ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KYCGSQWMQHNCSWRJATCXZGRTFJPQFYWJBLIVJDOP ISGGJBSNHRYGDVAGPEWJQNLOJXRGYKDVEJRQDOMU CANBCHXXIHVJPKKKZQOFBXLAQCKEMPAVGBSJSZOG YICPGJKOJQNOZWLHMKJRGYEPYZKGARAJCNCWOAHO LMLLPNCHDDZFGTMJQCDIWJYUWTNAIJLRLFOAVMUS ETLMOBPHHUFHDKYLFMPJXIXFTYXRBWGOSXXWQOVU CPTKIUQKMZZEOWUTFRELMZRUXPLCXYYODMJJAGMR DQWXFDHTGVQTLHFKUCBGTKXQZZGGNHFCNVUTWOKD DZTOWFTPCWTNEFQKNVQFMJTQPYDNDJNUADQPDYPX PESAOKDUWOUDUAMTUOAEGXOHEJTCCGPIUDFKBHNM XTRGUGLNPXHICOCSYHVOJAWEKYZOYORLJATYITKX KAMDOAEJKSLMQSSOAONPMZAEWRRHFVMWEGKQBHZW PAJUUJUFQMWVSVZRNLCVDDHWVNPFTFUTFCRXRCGO PNPXPSNVRRWJEDYWMSSOJGBKYKXIUFJPQMLUECHF VFYBRARNLTXYMHCNTBFYRGEXFWBWGREHRFCWJIQA DYAZIZTCQJBZFXDNREIZLHGVATDKJSORMJJFZOOR LGESZOAZZDFEVOWKTQFFSVJIFDMQTUXBBHNUJCDM CWHNWLMSQYWFLIGOOLBMTOWSJWSGQFXXHTGADATO LNNZMTKDYNBPUMFPFIIJWUBWGUEJVYDVIXIOAGLO HVUTYHQHFHUAWBLWYRZULUKSHPPIUMUOGIBTLXXZ ROZNRIAFQTWZSCJPNUWSEHZVUGJJBXWMLBQBLJAW AXKKHRRPGXRMZHXPCMWDMQZJXTKWOZDYYJIMEGSF LFCHMZGFWNDANRMLVDPDXXQLAJBZFRRQHGRXHAYG OBAMJVWBZLOAKQDOUCNBGECJOSXECEUMUDKNVOPW KXEXFKZCSVPZACDHVZSLCVMLJZVVSIRZGUGBSXUY ULNFJUJTNNTLORIFQZDRPWGKSJVMPNLPHSUABCAV SBYZKHVAKYPHUTSCEEYLVQLFMIGGYYQGZAJFPBDI EENWLJVYKAOXTONWXSHSXRQCRMXUHWROGRDMCMRW LLYIKACMMGZRIRKUJEQEQMYPSZTQEKIZDJERMFXY TATONLGKASTSSILNKIDXGDKIKTGYMGFZJVJHQZRP GMSURIBPQCVSMSHSKEKEBNPYMSEBGTBSPNGZPMCX MVWDZHTMOSALZUZBGISFIFJMVMSJTVVRIHLDHSRJ FYMJIZXRZWVUDIUFVQOWXDGXWUKZSEWZFYHBNNUN UPRSBIEYFMKOMNRFKASSWGXWMTJGVCXIMLEBDJCR RZQRAERNQZWTXPZEMVQZYZAVVEYANZRNJLOWGBHM UTJBHMRHGKMRVXZPRPCSTBCHQJMSLQQLVXOYSIUD XIOITLJYGAKSHSHKMPAGRGCACKNSUBUXMNQCDBXP XPRHYBAUBHBIMUVUXOBYYXLBCRKOMTDWHTBNWJAL TZBQFSHJXPTHGDPFILFQSIBEPUTCWLMOESCBLFZQ BRRPQGWPKYZXQZUEOLEOFIQAWFFZWDGFNAJMJIRJ CTZXYEQYEGIZJPHLBVJDZWHUKGLREHOETOYAWLOU HEKYILFGOGDGUQELHPXTAQUOLZZGINCTAEDUIBLS ZRCOKHRNUPZKQZZWOCVMASPFKUAVYGXXGFBUONAN TGMJJLZDPHEZFTZQEJGBFALTNWPHIFMUUBEADCCF WYURKQTAWQXDRWTHNDOXZPAUUNPNNACZXZGIQAWS LPLXCBFHGGULSVWONBNCPKFCUWXGZANURFHPQGCH IZGYXGBHEGYLGJPULLHFCQCRBPLVVNVVZNZTGPSE GEMMWZBKJMFIVRRNNVWN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TOASLKABZSQDYAPASWUMEKIHSSLXAKPYMJTRQNBM ECSVLUDXVFINMMCWQOFQAKYPQGXMVCEIFZBGPZXL YNHYNLQIRPUFBYKVIOSPRDNUYMNNXUSGSAZDEIWX CFUHIFVFENQYCDTGJQCEWVAEVZNXUQEITJEMIFHS EEWJMEFUCMGBQCSMCQCDSMJBPSPJVTLYGLODMHAL FXGUYDTKOGFVOLINBNEURAGXGCXLZJHOFRHUKHIW GWHTDOTABYWHPZCOKHEJWFVPRFAQOVRBIOLFOXRU RTLNTGSNCYGGHRTRKPJXCMMOIRMBAWMIJTMBNNXT PQPPKRQIRZLYDJBSZISCRUALMHEHFWMZZPTURPTP PWAXOIIFPBVXAIVNIVPPJWMARPCLNSHVJSBVCDVJ ZDXUFMDNXEXWLATBBZKCGVXYXJLQABAZOFIYIHAE KCUMLKNDVGIGIOSYHCVFSVIIISNOVDNONSGJGGQN CFDRFOTEPPGLPELMEUEIOKQNSGPNZOWCTEKCQLXP RWVBGMEOTRZMGEHNPTQDNIUEBHMHCXGZOEIYWQHR QVHCGRHMLMQEMVEBCMXDGXTVZWFODMTCIMWASXNJ EPMNSAAXHOONNLWQPQCZIGEFBZZCAWXFCMGKEGYN QCJXPBAMGOVFFCSRCOFGSWGLPIOGHWHOYIIMTUNP QOYJXDIVNPYBQAXJFPKLMVUIVFZHPNMRUBWVATRH KYWGQXOJBJFCRMCNLYCDEZTMMFQHEIHFKDWJIMHQ NOAJADXTUCXNFELDRWPTDTLBELWOHPSWTZPZXVXG MQWVEHOVNPEFFSVPJXVUEJHHGZTEMKNEQGIGMECQ XLKJDVDJFKCCHZXMAYXHNOLAKMIRQEPIGDPATLZE SRSVDPWZPKGKPYMFCRIZICETZVXNXFFPOHBHHNOF COOUQNRPXMNYOEBHDTDLTEVIGQACBOUEZORGOSSM YLBELLWGGCNUTEZRMYYKFXSFLYEZZSEMFVBDKOTM FUSACDIAJIYFYQAJEWGWNFYHLMNXSRTJFUXDYVVO ZEVDTYKOHKBXQAXWKSNJGPXHZIECXWNUXIEJHSXB VNSBJGEMOPGADQVLDDCFMQOJXXXCJVEEQCIWHSRQ PDMBLRXYNPRDRYDMXOFOZCPWMPJTAWDFOIZEOHYK QFHRCZQPGVQZNDQCDIQSSGTHMWRJMZHGKTFUOZDA RFCDPKWAVNXLCFZDDXEFGOEBUHNMLSCUDYCWKUCX QKOHGCECBJGQZAVSCIQULVJOGSXDEFMGHFRSTVSX JOXGFSOBLQEOEBHLWOBRFHOJHAJXKDJFBNIBSQOV LEHEQIEZLXHKGMFZDFGXCBMVZHOCICHCACQGMREO DNCRCVRGLNEGWRZSCZPCTZEGUJCYTGBALJVBYASZ IQAKHRBUQDINDUITJAPHPDNCRKQAACTWFFMIMDWF ZQDNXBXTGZPNCIHMYJIXBRBAJIGTUFVWTYJABDIP SIIPNXVPNSUAPAZSFEBTLDOPPERMBVFWDGJNDEIG QQIJSZMCUGLVPWCUYAMJRIPQBBBTREIVFYCRZIPE FITJUSJDTMEVUETCVMCLNWGYVQBBJIEKJNVNHQLK EOPYJUQSOEXYISJNUOQBADSGPNOHVRSAXQYVBAKS UXDYFADETRKXHJMQTCWDPDUTJXAKFTFPHXFRTOYI ZPQIDHAMPFZSKBQRGRGJBFZCAWUETXJJTBFVLGPP XAZFSKAPGAODREQGXDGKVNRKQWHUFXFKFDGUFQVJ GSXGCNQCENIWASBUQUHUGISFAWDWYQSGOWXXDMBW RQTOBVBWFSLAPHJVZWBEKSNGVMXRBIRIRECSBAMV XPVSFAUIYOOMDPOQNZZUEKTPPWNGCOMRXZOGHIMF ZIEXBSDGKEVCQETSPDQM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QBNVOGBQYSKFIVGZOSFFWARPTFUYNQARPSFHKHWP JOQMPNHAVJFOZXTBOHGZYVLDGHBZJOBDHUHKSHWD HPFPDCIBOHLWAEWPCWOQDCBQQPJXHEAHUSWVPFDN BDCLMUEHUJRSPYZUHHQNPVMZTQBJYSAQHLEFJTQG OJZEAAICHZEHMASWYZDVJIBXFBXJEFSXDPMZZULC EKAVNUZHUJMBMSWDEAKNUJPUPKRAAHKMFAYGZZTY HZGZZSQVATLCCLPMUZEVWHVNOBKEQTOHSRXXQESV OJTSFEWCBNHBRKVVIJVIEEDQAUSKBNLJOTMJXDPE WHZWJBVNXQRXXNNNYPLLQJNXMAVHRYHWLIUQYAEZ HDIZIOOFOMEQQCQHVVYLGYVYSPBOQHNSEGEDPWJU EJJPJPPQMCYWOCHUGPODJTYQLIKCRNOOJZGNLYCT XVIGZDMIFVKBNEXYOTTIOUUCFISZSJWHFMLTQWDD CSAOQZMFQULSGZXPHAYSTTZPXUFEMYHWYNGWCZBD ZUKDQVVBKLQQYKLKAQPKNMMISYSCJMEZMBJRYYRG NARZHEHAUWAOLIDLXFANVFMGSYVTULZPEEQYXFJD OWGBNPCGIBXDWYRISEATVFJGEZETLRYFIBMYHJFF KVFRWRAQPKWFRSZRUQQTZJMOQWSBHHIDVKTYWBJP DJVMYAJXUHSYAQLBSVAREHPALMYJAZAZIOEYHWYC HEMUTOQQSAESFVRVAPFMDTZUCJYFEFZBFVZFEEXQ EIMZLTHVSFEYJHGXSYNHMBHWJSCHERYQIDODNEGV JRGULWJURJFOZFKGKHKLYLHDQMFUFRXILJFNKBZN SBEGFFHSJDITICASDBFDVXXAWJHLGPLWSNRGCBEH YNGPYAQBAUPDYTLVVUAWAOVKSNMFMHKEOZOLJOQE HRJEGWZXXCYHVTTXAUWXEZQLFAZFLNEAAZIDRDPB TOETMPVLLRIVHIBDXSTOTGFVMFAPGPDXERDZBCTD BSBEOCZXAKDNFOILMEBZKNNRULPKGEQELUVYBLAD LCUCJIMZLKMNYBWRWSTTRYDIUZIRIEUVUJDQHYWJ DMAXCLJKAXUERVTRPUMQMMSJGMABRGAZLDJZRLJS JPZZBQJVPHYXPTAOMBBABJYZCJTQYBUIUXIVYMML ZFVPNEQEWJJZHVNKWVPRBAJIFIZUSYUEMPWOXOHH WURQLBJLUKZABZGGQGAKZKJDHKNGEHWCSWJVHAZE REASFYIANNEOJZSIWVBRLCUFVWMSFMZXMIVUXDEA RBSQCGSSIGLCJLQAVTCFHLIAIFGVYMFGSVIRGEKN MTFIOPJXWFYIJEBRPKABMTPAZTOYKTEKMPQZPEDL IMNAQRNYGIKPNZGFMQJMCDWEIFXCOJOCIEQOPIAO QBHDIEDDSXKVFUYGMYVYBANNAOYJNZVPOOTAHFTY GGCXAZHWWKXSKZZAEWKCSAKLNQQLWUWXCEQUDVHX XJPHLHBGQGWLKRBRZCMVHMJZXDQULBMHCDTSSSOV PYSVDNKGXMYMVANWGOGBPAKTBYJNUWHWSYNSTWFM QIDWWJCZFFEHZOYMJAEGZNFRSPWAVGWZRBOVGJJO LHNFZDVAPLLGGNQEKKXBFLZTXNUILOMZWMJYCSWK PSMEHTRBGYNHDQZKINZDNGVLNOHEYJYYZBPGOMGF YCHJVLDMPVBXSHVOOTLLKPZKOZRSRFEKPBKYORXP SAPNUZDWYAJRLDTLAWAHVCQNFTPEPXAPPGQQCVAY JSTWWEKHTXOWEDZNGXETKAJNTJNXDLNKZPRSQSQF PGHSEKEHPKNFUQVSQFHRDARBJWGBDXTYFPUJMCDN DPNBFPIUXMYPSAUCLNUULEENLMKYWKFEQTVBDGIR ZTVVOWGLIMFILPJPZJEI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SQYBLBXMNQRMGPGTYSVXCLNJTYBTCTRGUAGWBIRM ULAKPVGGWUFNFFIBXUCSRLTCVGJSWTYDCVSKZHZA YTSKPSSMHFWUKVZJMJTFUALZDJSVIPLKPPNGPENH UJEXCHLDSXUGNMCLGUYGYWRFNCUWSEGVVSXSGFKA IPJWWYFNLJXFGPDEUMZJRHZSABOUWWCJAAMXGQJC SBBVNHOHYZHESTPBJMIXALYWNYBMEQZMXJLYMPEY GRIJKYXTOJFYRNFMQFMPJYAQFQPSKKSGBJJDTQOV XUBGMMZIGODOHMISUOFXRDIMBLMOWIXDAFNPNWRD WSRCYPAGFSMBZCBXRRGZIJLOKEGDMIGLEATEITLP QIFRRKHHEJXOVWCKBBWGVSJWNXWWKIYELLLCMXRK ZZZCPWIROYSXXFCPZCDUBAZLUGJOOOVZPFLEGLOM GCUMAOOPSRKCOZKUQDKQJRPIXNCVITXIBLGAGAPK YAKFBVRMVUSMGHRITAFPYUVBDNUWEGJSOPDYIFSY UHTAWJMPNBMXKPGARHVAVVLBAWTYSKZSMPHUCLYN NBDCTECJJMASAYDNXKMDVZOXSEYXRYIUPBQZEIKA YCCTUBPRXOTVHRTDRPTKVXEHTPUMMLUJUUMBANYT ZIRJUEYQGULQBITGONMYNYYAFRLRWMWBIGQIMVLW YJZGFIRCEJGNWQWXZFQWKSGQCXDLGHMQVZOJNDCX ZETTRVOXYYLKVXHCSOKMACGAVCVWPXTLDNLTOCHH DBAGJUCRABRYTDPTUKLDYTZEIYSDETESMBZSAAYX XJZXKRYBTYHORLUIXLGIWKGBGYGEZGHQLBTEKODK VGFWVGSSVIFAIDDHEUAZKXRXLRMKORYLRNRSXKAV BDMCWPAARDTWISRCKDAYCJTYFBJVKNFNZVQFJIQE UWISLYYVWOQTJTONHSMQGRHLYGDWBKPHSYIPUHUG EDVRRVVLXBAROEXLJUPGPBNYXDRQZHONIXSEPEYL UKGMOBKWLDXPFPZJNRHWKYDOJEBDCZJEHWSPQOLV PZTHAKBTEYYCVZXAMOWSUSBHYVDKVKAOGOAXUMWU FANPSGSGYPERLAJUSGMLDTWKECXDEJHGBKXYMNFU YHTKCFBLHTPPBDHECWLGTNNATJUKNEXMWQRBVNYK QDAQBRKWILKBKMSADBFRYYJTXJUFUBOOQHMMHFCT TLJGQACIAKVCKXCAPMMMJAHXCZKZSRSRAAEJMAJK GAQGIHEZMXLCUVVWLYRJNOPXRCXEVSYYSBKVTVTF KAPFLOUHSADCPDUOPSGUSIZVEVWZBGDIUOZDFMRR QYGLIWKIKTOWFNOQHUZOWPXNSDGIPUUPFJLWTKKY UKZNRBYEZFVKTGBYNUWEDHUKSFNAJJMXQLUGHLTG IKLUBBQKTDSVLKPBILVUTHOVEPZAVJTXVZFGSMAF YWBYXKCPVFACVPGTLOEESYXCGWSYWCBVJNSOWZVO HFKVBJXFPIWLKRFVUDTEPUYDEAIUNCIAFLDLCMJH KCMZSUAQFULESXUFJHYGRJTXMRIGEGRPTRQCWGBW JRJDBIAHOIGSWFVWPWVTZPHTZTKWGFAGMDPMYLCC NAKAPQZATVQWLBALUKXYNEHROQUCNRIWDDWBMHEW BFNFDOQZOILQOBUMQCIEXKVGDDJMEKTTXBIWTWBF FYJCGICCPMNPWSRYPTWXJUKBKQCMRWUFYBQZAIYK OWVSHDLIJZRFIBTLLGFDLDKXBLSXVFHMLJROZPWZ FXKEBUMKZZBZCBKMOGVPORGCDPVGMQGHMDNANLEE LGQPEOZOSAEQEHADFDVOCKRKYKMZDWQWWUHZHVJS ZSHELONDXRRZOOJBCXGAUSMTQVWQXHOQESUWJGYQ HZDJBMFFEUDEEICRTUAP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KTSAOJLSHVSWGYSACSNAFTHOOXCHYVKCHLALYBBX GJPHJIGXYOKKLBKLDKPSOCHPJQSIDTCBQVSPJDWM OIMSCFFLNMWSCGRVRLMRJLSRVEZXFPPMTQUTPXHF QAKNRBEFUGTWVBYOVVQEVZRTDDOUPIWLQOSYQDFW PBLIXJUXKQOIHUEWFJOAFQAWSPKFBOFJQGGGZLGN VEWWGGHGIBGXKUQTJWWIEEKRADRCEFTFLVOHAOZW XMAFSQGSIIKOXTZJQXQAIQZKYHWCZHTWUFTALKKD EFXHVBAKAHRVMYYGDVACYHLUIAJWBVJNIFKWGKQD QZHFNFSWMCKAAFZGODGEZDEAZUYJWTLWSTSMBSYI OARXWSPAPBCDADVAHSGJQGCDUYGZDGXDJWSUQZPG ZNSVUPYFZVGWBGNUXBUQCVTSZEEWQFWDUOZMBVZO NFFUPUSJQDFBSPFBOKBRCJRWYBTHUOMZOOXGSSUS QRZYGRKCBVDGTUHZLNSEEPFXURLQVDDLGYLJIYOG TJKGFLAWGMOZYGSXQQEVGASVZOHNCKMYPAUGKZKI QIWMRKTKMBFIIRYJZSBBRXYLGMWWGHNXTLPRTZMV QTLBXSFKXIMZJSGDSJUOOQILNHEWWHNNXSPIHJSN DLEXUMCOLTTDVUGMXRXKIYYZPXXOYULCJRJMWEFX AMEMZGVQKRUMHTPEHMKLMIOLDWEQTHWBSXEBDJQB CFYWBLUBLATBHCROVTVOCDWLTCTVBLQUSPMJANQF ZGEQZUFJVPEZIXPOCKAEHNVGDJJXCXKKJLXKPPSO OGUDBUUETDYGYUZQJFUWWQELCGBHATQRXRUAXKOH YQBZRIOLNYKNDENPJPRMXMSXOZNKAZGFUIIBLCVA PAFIZUNEPQBRSJCRQFSDDAIZZOLDRDFHNMUXOBRY ACOVUMIHZUIRGLFXQDILNGAQRFPVQNXTGLARHUDY TKAGNDQGVGMVKXPOJVWHAQZBVKJUCQKREDPOVHDX ZQOLVQBQDNQIPGMWZYPZZHLEMMYCNIVWBDDLXGEY NSVVPOUEQEUMOIRMLXIBBSOPTKBLMHDDUVPUUORL OHEPIQNPTOCALGDEFACJHIKKXQXKTQTANTNDYRVN KCSMORSKRWWRYVXLFKFRNLXQGLAGXQUXMVHERXJK XOUAMBTVCORUIYGOANUDOXQMEYMMACNNLPFVBLTU XMXTMCMMBGORYWATIAAUGTEHTGDUMMSFYTMEGXUH WYKDDBCMAJMUUEVDFJDPMARWNASVXGSBOJYDTFUB IUGUCITROMLFPWHIAVBFAZOQZAZCASHZAVEXXPGG VYEDTULFEIQHKYCEYJJKGYVUOYIBCNFVKODWBTBZ XLJTPGZNZCCJQUMFCFQSFDRCWSIUEWRHUIHIRIMU ZBBPASQBYENNETAGNCGYHBVBBFGESIYGGBYTTKYE SCFALSKWTCKSKRWDKGEZLPEOUZBGYCCSCEGLXEEX SHRFARKRWOPDCGZEIMLKZSSQOWVCTANDPCWWJXDQ DACLKUCLDYEQHOMOCWRHJHAWBRKAKVWNQYXVAIYU HZKVEVHEKWKRTVGNQXOADLRIAXFENYQRGQXLBMSR DQPFPOGCRGPOMTNFTRCCQHRVHHXTAQMBFCVVDEHJ TWCURPZNTHORVMQQKHUUQZENYXZSBGRGNTEUQCQF ESPGQPLEPBMEKOBNJEUTPULYPOQJDQJLYEFHBXLM RLHGMPPOWQDKAHMKIKVIWXPACDIJVDSPKBDXSUNW DWEPFDQLVHRUQDHHORYCEFYBCQQCXQNBMSVKZEMU AXFSTYWQOLJJFNXIZBCUKLYJACXNOOJRZKJKFXMD OIESBYPICLOOKGEIBUETOVKSKIJCPVWPSVSKYWKI PQSWMBLTZPFAPHIKWSSD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DIFFPIGEEREIATXKGHOHFXAMREHVRBQDPSHSVBRQ NEIJGCUDDETLFGJIDJNIJALAFCUMVWCUXGVVHMEZ FHTBKRIMEKEWLSNPZDFXKWGQXLPBYHSMHYKOTVVD WZAUYSTSDDKCZKCROXKZUFRZRWUUGLPICZQWGIXD KYPTIDVLPTABULZKHXXQXRAXDYJLCMGTTEKXQSHJ YHEFPGRECYKVOWYNPTYMLHZBEKKXGJDWUWNGLRQE QEDRXBVVZYJXXNIPJFZVFAENJOUPPOKJGNVFDKLV XBSFGVFAAVPCTOIXFSSEUCCWISIOZVCSYMIONDPB ERRIPQTMIYKTPSKSSFJZQRFZFTRCLSTRJYFQWCFD GNFMODKRCXVFSYZIZBQLVIAMPFEDHQLIOYWYJXKC DKIHBMAXXLKHCRWTVNPCRNPGKXOCBFZPQXSQGKAF ZELZUWDYGISTGIEKZRZNFOLOUCMRXHQJJANOINFH PYMXFGAICZRTSYLUQOCASOEDTNYEZNTYAFULTIMC YNFAZKHQDEABHXRJROEKIFIEVIMUTFVLRCUZNNKW BHYDJHKPOPTTDYAGDQTKWKSOVCPYYIWMTTGRICYR HQHJEZWNHBQWXACVZITQMQNXZSGWWPTNRHOMULIX BKOGCPVYQSLUEEJOJFDLGHDEOOYOHDSEOAETIKAQ ZGSSGUJKQOQTQIOCLNSFKRQZZNPVFXNBERUJSBHX PVVDDQZPWTYYKCVGMQBVTVTBCYRBCVUXWFAMUFPW XZZMOAXYOLJXZSGLZLASQQUFDPJPEFYDUUZVHFMS NHDBAVOLMYYCLGXPZETHEFQIPAAZZHVBRCVPUTCJ GQDATAXSAZQQLDSIUFVIJSASQXVSQZSDABRGZUPP WEFXENBLXVADEBZZVAHKSPQOJYIKKAILHEPCVYUM GNGQUCFRPZNKMWUCGWMFYKVZJQEIRXHFYIMZQKCR IVCDNNUKRMXVOUYZYFVPAFVGQZIHMTFIAGOJGZWE NWMEKZXOHTQAWSKUZSGCBWLRTJQVNBRYUSKTMDXE YCRHQXKWIOGKMUTUCYEPUFAAMXTUWLTSALVNXDEF JCEOEEUWBDMNMUVTSHVMATHKYPWVXJLLLRXDYIBX UMSSCKWHMMXYYDCPIJUMGAPCMIBSPZHLCKPSIZBQ UVWSFDGXPVQNAAJUZQWJZZTQRZCSXXEAPBOCAACK EBBOXMSUSUTFTLIIFLIBMEEFZMQUSSEMCRZHJFME FDGOBXKMEIFJCETRHCSGJLZPBHSKYIDYOOYYISGL JEDBEURNPPLXXRYHYFGCJCLGJFUJFBNXOZYLVUCV UWYWYRQHROHIPLDBZTGPUKPAFBKPMYTDUSLUUFGL MUFBTZUGYTTFLCVUBJDKSOZDKJQIGVZPCOXOYIYQ ZSRTPQVFUEMSKJJLBVQYGNYQGTKFEGDKBQZLTZEZ RDATVCUYCNNBIFHJZMVHAWNFNDVYZWNZGOMRRWGD YJJFOBXGKHKCZFGGFNGSHFBITQMATENRSTTLENLL SAWBMNEVOGZQONXUOKZBGCGAHXBPZDGZCCAFURXH GPGLXMSTBXFQTTKCLVDTGHNZCAIOHEXFMELSEIMQ CBJHIAXKECUNZGJYFKIBDNEMSIDRVNUKPQOALXCR RCDRDIZCMBBYJWNSNAEPEJZXPTADLPQDPYOOWWRL MWTIPLYGMBLOWYRAFOGMFGSBUJJYDMORZYBXAXIL GVBUYPEUEYPAERAESSMCPQAWBIYILMPMYXJJELYV KACPWCTIVDDVYELUFVDXEDYAROJHQQEBPFGWRNHC WSOGJKDPYKUGAGBECRAUNBQWYSLFYXOACMBLUSVH IHQZENRUDFAQLWXUFMWBYJXKHDZCPVTTRRXYIQWE DTIOBMXOKIMRSCYOBQGW
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SAOZASFPFKGQSDDJHQLNPBHJBMYKPWLPJJNTDUZX FOXRDJQMQHOOQSYIYIPYWQNSHZUMNKXNBMGFMUCD GKMKVXDHAGNHIJZSFMYCAPEYTNBEYRZGEXMZVWFU BVAUJQCOLWUORRFAWTTRLSJRZNIDYFTJTENSWHXX SDBXXLKIKTEEBELQBDFYQMQQXCXTFXGVMVGGPMPT ROROIICBBVPMTEWRFDWBZAXAEMQHHSOFMFEYDGFW SDTPKMWOPOHBGCSDGXIRXMIRZPTEBPRCXHLSCRBO YLPJYYAOYTRWBQPCCROWJDYUDVIPWAGIWVHKUQJD KTISFTANICAUZMRSAMWUCFOKUACCTBORRELKTTZW IOZWMMWLXUYIAEEOHNLRXAROMEXRHAIXQZVCZNER ELGVCGWVLUXLOUWKLHJIICQUXDBEIOUUZYPDYRLJ KAAHMOTOKLHCYFUYOLIFQQKQZWGPEDXTZPIKJZVM KWAUHSHFBMMUGSMBPGHHEFZUMPVVZSJYNRGSTAGS VGAOKLTAQVNZKPQJPNCYRYJSIJDMSUOJHWXZZEAH ISYPBUFIFRDXQRQRZEUAVHAZZPNQDOPQHBLYNHMX LPVWIEDGXSKROWRIRJZQZCEJRHNGJOUYEIIBKHRH NKJMJUQIDORXEBDSADFXRDIBLIQDGPETENWOXINE AKVISQAFDJHFWZBDCENPZGSLZIZUSFDHHFJHXAUS TFRETDNKYSPEBKTMJJJUDOGLQYOZPCBMYTITDVBW IXHZIDJLVPAUVTXMAPOJOFDNEJALWXQQLUUOSEVB CCXCBAIWOUKZWZASUJKXHQBKMJSEUGXWSVTBGILE YKPJRTDPUIAKGWVPBEFLHEEPVDZZHPFLVWKNNFLF ALPOLWHVAFHVQENWZYTGCOSEVTIPQRUIQMUTHUCD UODJYTIWQRUMXQLAXMBZEVDGFRRNFEHZXEGCQRQT ZYUTRCQTGFGJZIPGNPUZZDMEKTYMTOYMGFBDZVEW KBSERSKNASRFTTUMBQEGXFONISXDZITGVLPPBIJC TGEPOYWYTFHZXSYYDHEPFGTHYZELAWAMUEERGXCD UVAKVVIWZKIDIVXYMBNYCWMUQCADSRANLXXJZVGY OVJGVKQEXORGUCJIZTBWOMFQHHVQKXTJWMTFAUKU TMNPEMFNRXQRXCQNVHPQYMCAPESQENXMBHVLABWW HOQTOKNWNZXAHOJBIHHCWLGMGWDBLSRJDWFUIULW XWULDZOSUWDRPPJYIHGRYBXLVSADHHAEXAUJPLOZ VNSJFJFGDUFTOUABZDUBUDIMSVHBEUNVXPJLVNRL WVHLVHHEYCSWGSORVXXDAYMWYTIYQUYZNQZJLPHW COTEUSDITQMPDNMXPGFPMTHXACIYVMWKBHJHDKQE ZSSJFUEYUKNAOTEGOMETJHOQIHBYUBUFCDVTYNTK FOTCPZTGINBWJCZOVRZJVIQFUFIKBRMUYUFJPTUW MFVAKLOASYQNHURXODNFKDUSMVVFFOXRHGLFWXDU DFFJUKUIVVGSEYVYRDLTNRAHKXBRPNUNHIUITGGH RMJVCZCGYEISEZUFFKFZSPLIPBQMOUPSXOXBJOJV MAKCKRGUDPNKMDTFAAJEUANUXYUUORTSJEGBBJUG HRMFRCDVNCWVQOVJSHQZNBWPFDJLWVRSJONGCXNN YVTGHWJXOWTHJGQZWZFVLSFAJALYRABWOMGJSCVK UGNZZTDPBCGLVGLJKQRFSECQYCIFREQIBRCPTKCV IGFVNWXPJBFIXPSYFKYNFODNEHIFXKBWGZKYSAFB NMKMIRTFJGFIZWCBZYVOZFUPOAQUUKMDQIWKBOXU UGZXSTHJTNVNKPICWMGGJOVMZRLGSUZGZHFDMGCJ IAUARBOYWXLFYRYENACQ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OZUVCOYFCWHFBEGKKPZOUZPGTAQYRQTWHIKSTZZW PARRHJDDMROUFWRITZHPWNRTDANKVIVEPTKHDYZV JYITBIZTYRGYEEXTIXHDCMBJYUMHCHJIYNPVUGZW VABRFPJOTYBJPSRXXQJUUZNXTLFQUGMUQQEBSETL NQSQHIZWCCCDPZMLSRMSMNGVVBHKJFFRWRZCIMSS THGKZMOQOUPFZLMPQJWETDGOTHADBJURSFJZXGAY QOAGXPUTISTPOSNKPGYHSSNWUKMEECMHRMDVOSXW IMEBPYFIRUPEAFYYZJKIBSZLCOMYTRADKJKZAEPB YNIWGIZCIYCBOTUWGVUTAFSLSTPKBUKCPZVAZHVB CVXGGXLPQCFEWHKXPXZZVVGZGTTEWKTQACKGEYGS FRYBQMXYOBKGIVNLEFPXJNIAVJWTAOLJNXYNTXXR BPVONMGLJGCSWFTZKETBZNPQYAZBNBZUJZOASRQK UUSQZPPTLHMNCIFGXXKWSOAQAXJONOINOBZJMQXD JUBIJZQVRNXCPIJWMLDJFKUTHCQCVUKWJTZQPUAJ MXDKBHJIBQZUSATTCLQTKYIFLYGHWNDOCAAHAKTX KHTSCRUPNPVTNNGURWGQHOKCFYCEHRBEQJCSXGDA PYZEGSQDODZZERLSPIMMHPWEGYENZXSCARQXFKWW DFOURIVLXTFTRDFCTIIROXRDTSOGWVYKNUSQPALO DCFYKDXPWSDRVQLBDZSDAWBHTAKIEQTVNQMFDXKQ FQBOKGWBXQGZIBEHSDPTWABENLUZQVWSRSAVHBOP OVYPZDRUQMCJIVZUUQNBLNFKHWWMXJSGCKDAFGVP AARRLFNJBWEHXNJJOMYVVLUDGTISDAQBNVCPLYCV GQGJYRQDBDNMLNRDAKAYBSKEOYVBTAQLRXWGEVGA WOBCRCPEOBVIFGGWAJLQNSAQOIXYPNPDCKXCAFML GABUTFEXSIAMFKJGBVZUILLEFEEBNRRWWELFUUBU NQGZXDOMFLESTMWYRBSEZIUEHZJAYOYEGSOEFCRE CDQXLFROUXTENKNCRAMCTPKJELNEZBBWLOTOSZMN PDFNVAAETHWGVYLJMGCMLNIYSKKKLRXZMRSHJYEF IVACGCJLAPUQWJBAKDELUXOBYRMSHUZGCRMCSJXE SAFFYEXOIZGRYYLFAACEKLWCGTJFOJHHGIOAYGIO YZPVVZHCYPILAEIPGYEJDQBCHRVLNVUJWZGSGTTH JHEQJKANWWGDUIKYVUBHQVQZJEEFLRSWCJXOVPSR IMGOLQQICSGZHKSIKQIMCLFLWYIYAWYHPHDLAFKL UUGNTYUBCZEHYZOSIRZBTCNFCFBDJKODQTZDIFGK DNXWPGDFRZROJWNLVKJNQWLXDZFOOAWHNSORYCZZ UARNUVHONZZPZKTRGFBPXPGFWLEBGNDLSBJACTJD IVQCHASJEMEWCQFUMUHFGFZQCIMDINUETGSALFQE VPLUFEHDXVIHBTOOQMOIXLISLKBZEBPTDBCUMFDR AHYFZYTDNZUGSUFCYBNPJCINZPYMACUWLCEKULNN GCQAZSXIDWEDTXEROOFRWUOJJKXWIGJDUZILWAPI DAAPSFOIQLEXOCSBRWBLCXKPTHMGSCVMJPQDJWCU MHOQSYURCKXUDCQMWJVZJLCCRNRSYYXJFFNYALDC SZCMHHQSYXILHBPRTTRQYKQDZXAAFKBGVEDIZBCT LTLQBWXSEPZQXNWSWBJOVOLUEKHERWRCHBFAXTZZ DPCAKUERZWXZWKHBXOSJDRJYODVDUZRWIQVDRSHZ RDBMGTMXZTJQFCSDEKXJTWLJWFNYKYWPLOLAQMXA BDCWEKQNBKMKFFZAKPEYCDAGTKZHEZJOVDHHUNBR OAKMYSTFVCZEVBKAQFCD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      XTYOQFDBNGHQDOOICXCIOBALVKUFACCCGVYYCHNG ZFNPPZEVNYPYZNZTLYIDJHFTYPHBOEVZUTTFTJJX KLTXBHFBUEZAMFYZDSPTTPVOOPUTXTIIMMNXBYLP FDKLGSPKZGBGEMPEZIWLZHSRACSNRKDRRDXAPTEL UALLEOEEZSMYVGOUKPBHYTUJUHGJKPDZAWFSXGDV NXPVVGSIFINDSITHTEHTCKIRPPPHDVOACZHAPPLE PSSAPAVVYSIQZAAODDXUVSJNMOIJBKNKKRGRKRFT KHSTDFVBWUBLGUOFWEJWDHHQNQHYXBBAMAMZGYTZ ZIGVRBQWCWPXLRYSLWLFPETLARZDVXYTGQJRLVMZ RYPZXLRMKNGZZBYGMJPMODUYIOBKOWLDESRPKJBK AHQHPPXGVHJHYSHAXCWZQUHVFLWUYCSENMBQQRFX SKIRPEOOHRRISRTGMTMWWMRLUATTEVAKYQKQBKGW IKDLEQZGOZRGIXNAWDGHNZOMJCTNQZIEHRKSZDGV TLFFOOHBSKKWCJKYQEFFTAWRAJYNROXKGVOHOCLE YMPLTSOFVHXABETRIDLLHJHQSAMMODQEYVRIAXYZ YSULBYIRUSDVSPPOTKGDNUFBHWIXWDKRYMEDCRYR CRRPKHDUEKMJCSDINZEBVERJBCZYIWMRBXZNTZHI VIAHJZGDMZAQGPRUNCSUQAGIZYNZDWCIZWJJOMSN EGQFPVEQTLIWGJZLJAEOUVKXOSIFMGQKBDPIYGBZ XTXTSCHXIBBMHEKDJRWFLFXKOBZTRRGEXVAJIANF LITJVVSHMAFJHSGKSGZLQZTFFQMOVQMKESZCCNZQ QRKCETRSVPPAXDETYXIFAHGCIVHJWNNIZNGTOAKQ WPMDEHOPPPNYIYHMGTPMJDFLGTULCIJIXFOFTFXR KMETCWWQQIEOIGENQFOLYPPKWESAOLDDTHJYNHXD HCKUGDHMQSLLKCDCYBAHLZFCOTMYAHBTZRLBAKHW XBXDKKWJOPEXDDXOCRPSLVJJFDFBHBDZWSVWBDOG RCFGUTXKSJFKHNAIUUUPVYNYPZYMEZYFIFMTODHE LZCUSNIWENVKANDBMRZOGKDJYAWFKEYLRXNSOILP QRSPHAQODFGDSVSGEKVEDPTTROFVMLWKVPGDHNHQ NWDQODGQUPVFKQDZMALZACHEBWECQRZYTEQPIPFM TTMBJWQFEXJFGXUXLGJBBFNSJZMBXPOHCTATCKXF EDZGGKILUPMLXLMMNMTIUMNCTYTXLEPCMBMJGTHV MZXLDHLAUOOLDZOEMNUXRSGULCTFCGIRFXIPYLRH JPMVKMNJEMTKGGNSYYSIJOOOMPUVZLFWHBPJSOOE ENZTDABNXJPITHSZSSRPFSQQABAULJSZVLQKQJYB JNLZNUWYTJERWGDRCWIWLCTBXZIGFDFUJFISLEZC IZHNJUFRXQYJECDVQMOJUDJSRSQOPHASOWDVRZVL SZUUCFUPZBRIIBXFHGLJAVUSOFTOATJZHJEFZDUZ BFLXMJGWGJJGQDEEHOCELYYGLZCJFPZRBDLZSYEG GFMBMVDDSWKANEQEVIEIVFMSODRCAJEABMVANCEU LHQCHSHCXKYSCPQNHPVCHOPNZXUAUYAIBLIJIEHE YFTDETCXXCROBXFJJHRSQTEZWCAFTPUGMQXKHKVC GFINCGJSCZDOXTKZJWNBYAMDFGILQUNMVBRZKSIH VMHUAPSYMSFUFWQAXEGBTVQBWPHATUZRJXRDIESQ JTSQAULVKEAHXUHXUCWZLULIHFYWKOJPEIDXAOFX VBEKXUTYHQEGAJZOCHPTHZOGSCQDIPTVUCEMCCUU ZFOPWHNYILZKYOKPVFFDXENQXINEERXYXHOUTYLM AOTHBEZVSRXZZEHOZWFI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SDOSCIYIFGSVMUPSEYKVKECGBCZYAVLHHBFEEZZY LXYAHRYVSQERCNHWHKDPRIRKFLLRGKHSBGYLMLZB NUQLRHRXISMGKVNYIAPFQVLDQYCALHSKCTOTJNGA AMFSFYLGBWYFJMOMYWZRYEAJFRBOLLZBWRNJLIUN NRDAUJXIYPPZCEJAVBFCIJUXIHXHUDDLQJDNUVNH YRLRCOEFOBLRFRHMHPGXRDPPGLUSXCAFRJYTXRXN EAFSOHUIVXHNHNSMAOATFCROZKRVRFINKHRICVQG AXUZCEDELLQZIFHVGERBLHYLLCHTKLFWXTEBXJPS JRANFQGYHPYVXKIEATFPLYQHRLPVEKLTJGYSDKPF UXVYGJCJWMDPUINQPCODZRDSWMVPFQLWWKLNEXZD XZNPPPLNGXCYGIYNYIUKCETILBWXLOVYCEDXFZNE FWVPJKGFJDGVXUUGZOISLDENIAVZVDXQYIAGBKTX PLRDSSPZAOMQAWNDUPSBLGGDACSLBDITTITFFEXP YCFXAJVJONXNTSZGCGKVQNZSURDCHDCHFMKYERWX TRVDIADRJYWGVZQOPCPZAAMHLZIDGIUCJAHWGJHR KYRBHYMHPNHFTUQYLKJKQBHOSBNRJYMURVZTUPLS XKFYNXTUOVBHYVHCBWSXCETEJUATIRHABCTEINOF ZTUAJCORKQWRDOVDNLEVOSFUYQIAKWRRSQYSRTOW FIDZAETPBWELCRGDJUJSZUMLNKQUDNLPKLQTXDAL SEVGMSGURWLVTFEQJTVKMVNHYPGBMPBNNESEQYZM UPUZMYCWGOELSLETBULWYZMVURMIEBUQGCLQGQAI FOBWUMYTSUYREANORCZJZANHSYAXVZXYFOOSHVVA KLQJHNYMKYCGBBEUWHYSVKZABNRZURFOOXFXDEMN NWSFMLMBHTDWNOFIRUZOBTCFNHVQQZSEHGMJGMYF BDPSGFGYCMDBSTFDQQSVHSBKXRQNMUKVRNQEEVTR UMSDRMDKTYBDIGKDQKULKLZKIILYDCPYQWWNKYTZ PQKEBBEKFYIWVELHURBXPUYPGJMJQQOMPZCMUPIE EIFQXSPZKIVFQQBHHDTCTWUGYRBPWEAYGQMWJHBM VDJYOFSDRRBOSMWLYLBJOUJUWHGWIEEMKPATNSAG EXRJHPKXMVAHDOQEGXQSGNJVVFCWEDHCUGQKATET EGFQUAJOOROGYYRWYWFBQXRUPOWSPBDRYZKNQZDJ LHWKWTAJSFPHOJQQQWTBWAAQZTOXHYDMUXMLIIYZ EROYFPXFBBPKODQXVTUMRVBIJLXMKIUPSAUKQYHB KCQZSDZSGQPWPNNYGWEYKJBUAUUYIGQEHNDBCHMY ADIPYITHVKOJATGAUQPZEEQOVUSMIARBVPXIBEAR JLCXEIMQFXKZKXOHCCXGTYGBUYARGDNYBVNHFXGE ZCODMBLKIJWEPRUMHPUYZQGBWKVABOVGSUBXBPWT SQMCOCPAIIPPHOCKOZCVUZCYIASFZEADDIBOTMDZ LWLUAKBGBZOIYIQYHMHJCUNOKXRYQJFZCJUGTEHZ PSPQZGCXULDIUPPXCUFHTILPNIPYLIZQCRNFWTHT BVGPNRHVJBOQGKGVCCAFBNVHKIWYVHUSGYOJEQRK UYFVFYAMWWIKDYAUWYNXOFMFDHTHFOBKKBXOAIJA APFPCVSPASDOXJJKQCZLCZSYZGPBMHSLBHDRNKPA QHELBQQRGWZUEAPILOHUDPZJRXMDSFJWXTDXCXXL INJLWDEDYFCDAHFAKHODHHFJDPXTCWALJUVLFMGL YHWKFPBZKNCGFTGXGRBBBDTRBSVZCYDTVZTWGBOX RQPKTLEDLUTTEKWMPKJTUZRRHQGGDVZAWHZEXSPA DACEVDHNQHMSKLMZFFZR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EFNHDYKIJTCORQPWCADCTUWAJLOJNVRBDCQIOUEI KGJCBDCOTAADKJCIUXOUJSTVEJPTUAJOMIOSETAD ACIAPZMTZCWNDYFQWMBRWYECTKQVJIQDAILVQSSZ ECCEZAGAAEUFVUOSKSBCJHKSCMZIKBWJYSWTBPGI OEKDTBYJZHTMSFOQNCHRPYBFHIGFZDGCSCHECNWK EHSSMEEZTNCQJAOIGHPTCLUYRIBEUDDDHGLUKNJD XECGXYWBXVMHNXYLRBNRDONFULHPQXIVPAWEAMSD MIQBOYBNJMEDOCMVLNCFGPUZTNQZTXCONKKUHFTD MAMHFEHTSIAOSUFWUBNMQWNTSWCOEISDKZFINEYE UBHFKSICEQACGXDJHHYXRAEULSNBARAYOZINITWB TPTNEOPNQRIFJILWRDWXCCOKHYZLZJHYOKZECTRG KPXXKUVWUPOYVGDQKGCOJXEJNZKZFSFKBGTOVJKU PZZHGUUOZHHPVIUYFWCXFLJSBNUURRZRWSUYPNET WUMABWGXJPLUZJYRWOSUENKYFANEZGQQFIRJMYHM OEUQYAIQMCZUHDGLJWZHVCTNWDIABZVCXVGQHKQK EYCRNSNFUXLROPNPOTGTKTOMCBJVPLLWQQWJRMWD BGLKANRGPELXFVVRQSLGUDQKUTYOPAUCEUXWXRVA XHXCMDEBDNUJMFTWTQWMQTWXNWJXPLKDXJTYPCVP XSJANHPZXLLIFFWYLHUTKGNBNKSCKEKWMPENQXDE MKUIDBJFGTIKEXNHDOCJUXAKHUWCGBCVTTXUPDAL TELSMNVIRPSUVBJHUSCSKVSLEERDREWLFZBYGCVT FKYHNDDOVJJJEHQKDHKSBULVEPOPXYRXPNBVEICO CKJYOCUUCVWPVLILKPCXCAYTFMCPYHDUCEVQLYUO NFINVCACDASMQPGKSQHGYYBKPFIHRZHEDWQGBYPS HZVZYBXCLLQOIWJTXDWURLJEKBOITGBLEPIGSUNW ANEBTZAQWCLXFLSAIIEDCJCXAVYVXBUAWMBRMCRS FLRIUUHOVSLAZIDOSDLSHMVIKSORQCGUSWLOHDKN LBWGBQTAKMTLAIMEHJQCAXVQWYVIPOOHQZMXFSKS TSDNGCBQAUKDRPLTGKHBYGOKXZRXSTGXBGEAOVMJ FYLKLYYUPMNEDSJHQCHHGLOENANZFCPGIFWGIRJI HNCXEYIZLKTOEQPDANPXVSDEWOHZFXTFXKTDKFDW AKODGETQFLNSAACBRXSLSKATRZKABMEZGZCUJVTV INACLNMZSZUUJZSXRDIHZFCXRCVPAFDENGRFJPXD SHULTDRXGTHTRSOIQXEPPBGXZXVYHZVODBHVPFHL OBULDHWLXLGNPEPQTZWJVLWIBWFGIGYXCMORPHZS SLWGSIXSQMVBYXBDHDSJVUCIUUSWRFHWWJBZUYHP WUBEMJHYKTPVRSBJBYRWHWNNAOHNLPYJSRJOUVBM MHAKYBNQCDZRGEOWKZZDCOSIEWRNTQJEXUETSMCU YFFTNBYQSDVFSVILVBAGEFTMGGJTKXVAMGWXPGJS KWKDEGVBMPTGFBQLWABMGTYCRSHDCPBEWIJXFIGP RYNQECZDOXYGRARNYYCTKPQIOBMGFSBCBYVWNPWX UQSSAPFGKMZFZOBHAZEWALAPQHQGCLRCQCHKNIMM OWPZVGNGFFCFZEDERRUCANLYYUESLHWXKCFFMOXS CUIFBWGAAPWCQXXMXTFYZFEDKOMIPUGTXYJPGJSK SKTZVIVSXCGHUSSUHNXBDVCAFWUEGNUEXQIKIWZU LAYNYCUZNXIREJNBVQZGNYDICNDFXFKMFBZKZTZQ SEEAVJHZUCDYSZZDNYXMODKTRGTLQCTRGXWUOVYM HTADVFDFJSETACVKVQYC
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LIOOJOJXRIZCVLFEQFJVBRHQQSYKYUQIUXLRVBKB OJRGJNKMOLFNOVYXEXNOHZSPMNDZUDCVRKTFKKQY WXLXNIGOEQLZDSLBHVOEJCJQEVTRZGEDOFWCQITJ UAVRLXEFGHYBPMORMHDEQJUTBEVDJNZJPEDQDJQC IQEMVJLZYQFRNCMILHGYELBSCRAABFQZASJLHUMS VZIGXEKGXKHFIJMUNTNDWMTCDKOBDMRQNOVHFQFJ OKYPIHRRQVLFEYSNBTVQKCPUTFBPWDGVOPGOANVK IQRQQLEPKZVFXJDLOKDSYFOAGSZTAIFNCZFTUYEI KCFYOLTPAQFQGZBNNKYBZGQGRAAGJGAPYZSTCLRA FBQOBMIOHMEOVNLZSZGMQUNBYJZPZVWEYRYLYGNH HISPXICZPHQAHDAPSPXZJDAGPEKGFKPQJXGKALPO XFVVGNXEXTZJIRIHJEVOKEBYLHENOPPTZHHKAUXI GMTEULOBTDLLXZNZCZDEEZGYXLAAEYIWKWAZEEJM TUFRNPJKXFPNBFOOTITUXDOJIPPAQROORWRLYVYP BGFDWHREFQIGBRUVGYAJXGFCKJEAEXDUGIOLKYFP VLNIKTRZZDWIWWMTEFPHVPYDNQFHZLRNNXHSKXWD PGRMOSIXPOVNETNQHNTETSHBTVLNQLIJOBMRJXDE MMDLIEBLCDWZWINYVXDXSYQUULFZPKDERPBEFDCP MHBPDGWIBDMOVJBFSWPZVFRJBRBXCGNBSFMIOUNR MCXMGTDTOMTKBJUUCQDPINGXOLXCPPXALZMQKZZU GRKZXAOYTXZGDRHYSQBFUECQQTLESSTLEWPYNMOT AOKJKXIRGYEGIWMJMVGKDCGEVQUUXJKDDMNHPUTK MLWYJWXZMNJMRCTCWFIFJVHFZWOQNQTPEKWXFGDG HNKVLZPDTMNPOYRJZYEPVQXHLDEGVPKKYHUDZHNX NGQHUNREKGGJXNSMISZJXNGUAWJLMTEGKHUUOOVN LIEXENFMEHPCTCHKENIWKIJUCGBKVKIXCFACBSXN OWRVZUDOHFHBLAMATRTXZIEHKDGSFLBREVTNGEHA TCOSHKZOCUTCHJTKJGZDJQRGDSBGOIPNSHEZXBCR RCBFXLRQYWVZAXMBFZHTDKBFQAEBYAAIKDTFQWWG HPMQZMCKVYEVFODOSVSPUZKELALPCVGITFSKWPCE ISNCWLZTURWVSFJJVDLPNLHTPICJMHNFKAPNJTLF BVLAUZVTYXWCCTWLVDCLAYHMJXBMGBQCOSAZUJTP FSOPQDBJQGWYXVQOZDAHVWAXXKLADXTKTURGPAVS UIRYFRXLWEZSGGNFKVTKCXVFYBWXDWWIATIRLLEO KBDHAFFSMNQVUVWDFLPJQEQKFPNVCABDTZQNAJKP HRFSAKJKYMXYIAMXICQANAUKKMJDCVPZSWLUCPJW IMTWCSFKCSHROWCOFDNBEGUNZELNGXJXUWOJOLXE EMSPMTWNDBQYQZDJBFMVGOPIFQCOUMVXBZIDOUKO FKQKXTDAURACJMCXKFWVPAGSVDCHPJNWEECDDJKT ULZXTNIMPCCUYMYAVKUBKZBPSAQNYUUBHIPSGVVC KLOQVTSQUEEDZZABDKLKPCPRENDMOEOBELCEJCIW RMHRXKCBPSNDQWCYXZCQMQHEXHQQKNNPRPCKGXYF CZWFYIYGHQBNOKGKHQZMZUQWQUAWOWGBICIEVMFR LEAKZABVCKLCDHZXDULVUZOGIGDNJMQGCKIGMXMJ ZELSMDNTIDWCJOAIFANHEOVFQBSUJMGJONXIIEUL RLYVLRIICQURCOKDFBAMFZLUCUMWUQNLVXGGLEIP HIAYIHEHVQUEEETTRTVRHKJEGPESDFRXCNOERVKB GHCRBAAVMQXFKIXJQOKO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JOMVOCQCJFDEZJYSEWHTPYVBEMKYOUOJXYIDLDDI MNGROZGJADVJZYNBFMKCVGZPKXIVEMYQDQJYPMGH PCHQLOWOBURSCLPIRTGMLTWZHRMVEKPGSFZKSBAV OEWGKUBEQWNQYJXNBDXBTSGDSZPLHCVCMSUVASPT OYFJHGGGTPBFTBVCRSETQKBPPPNTUKHJDSPIGMOT HZGDCRECNLUMDEFKIQRFARPRLDVGFAXIXRRHFZKL BQKPQFLNPEBGMPUTMXVKMMNCVKFNESVTTACAVEFR ZJJWOZWDBLJZHVFNKTRRZOHBWLVJGZHKFBHLMEHU VJAZTFYOMCUJASTSPTPKVHYSPFAQNNWMOODBOFMJ RVPLHJIBFOWTPXPFJZVICUIWOPFPMJVQCSORDRWG EUACALYBXKHWOIGRZAGFYYSLFDNBEIGLLWKWDMSH CGRYDOTNXZDFOPPVXWHNQPOLWTSHVZSRJBYVZQGE XBXPEEEWRCTFVGVNDTDDUGZTVBKTJXCHDMJJIJRN VYYSRNLQKHFKIJITACUHMRRIJHTFIGBXWMSIDYVW BFRDWLYZDAFWWYLHWELTVQQYFSTZDQDFOZNKIXDP IENRZCUYFGTNWXUPYVUQJSHYTJOEXTXYMJFYPNCT MQAYDMYUCJYSUDWQPLEVKCHAJGKPKYWBILVPQKLE YHFTVHRYTOQNPGUAHFZHYTUWDZUSFMGSEBWCJKXO ESGTRONPMAGVAJKAEJTPRVYKQMUEBDYJTKGFZUXZ QPCKTCJNTZENFYUUMJMHOCZSWRXOWNSGKRQCLOEL GQMGBBVMBFBCFYYUQTIVUEWJCZNADZXPABCBWSDU PKEPCMSICBPTLIYBAIRWQTJKMWUCBGLUCOCLOFNQ VSQUMMZDDTQGCNSTNESIWYSYXSSXRWYWBFNZSXRB MMWDAKNBKDDMCZFNUDJXTMPETCUTRWEAODNJCQTB HEPKCDXPERVMAQTJSHHCHZPSXKMKDHGLLNOOBQRW IDSVRVTZCKVAEKSEETBWANOXHPFAALZHRQNUIXEV YLITQOGRZMMRQNKNUVDCEOXJHLCTZZZLFNTAFWSO PRPGOVOJHABMUGEZIEGDAUIVYWGOALPQWHHENEIT PVXOQKMQEQAGVTYKFRBVLQFOFFAZUOWNMGZXTJSJ EFGJQILZWIIKJCXFREYFTPDRAZYVEOJHRPNSDTYL GVLVWDPHSGEFMWQZBEVJHXUVSIDWVQQOUWZKRHJS HVMXXIGZPHSLMPGAVUNXZTLPCVKANTTWIHYNKJHW LKSSNMPHGBLHHDTHOTRLGWTUWTGDMHOFYBLTPAIK CUMRFBCLMPBLQXBBRLXFRZKNWQKHASDIUSHAUPND FVIHQUFHOWSYZTFHORCSHZNJWIYBGGSMAULEOFGS BQMKXASYGTWLXTYHWTQVLIEAOIBSPZRFVRRGYNZA JJORIEHADNWNEFMCUONDDBCBOFIZKRGVLVHADPMR CUXXCRCSTQOKKOARDRRXFLUORUBRXDQPAVFYHIKF ISTBVDPQRYMRJPXPQPIXDNJQBMILZYJNKZVUIURH LKVBSZBTCAHEDSEROEEXHMZDJZSCRTHEKKOCGKQM KFXXCBVLBSTUPMLTLNQSMWJYKDEDSLWXUFGUHSMQ GUSABUPDHVSZEWSEXWLQEJUQGFCYQDESRQRRFCVD DTDNXBKWRLKGLYRRQJTBTHEGDPJCROUMYYAJBHQC ZAOYTFVSRZVAOFUYAEFDAHHBWLWYZQVLIYMTZKTN VUSDECSUBIEHDRTQSPOSBPJSRXQQFMRWQWIZLUUU XYVQPNKQFPLWHAHLKDQZZRKIUEJFENJGZLUHNILP HCYWYTUSQVLVBVYDEJSZYUPCMNADDPSFDULMBCCW XNPDZUITEDMMXHBJAWFK
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FHGDOZSBUDKAGEKCRDMTMCZRCZEWTNWTNZIQJKUJ VRFXDAPHWFMIMOPTXYZMVXHASKDMMDNHESUGAQST WMKZRIIHJQHMDQJWQKPANHFVROLZMKOFTNIMUITN JNLNCUPIFNIOICXMRPEIINKKWTRIKUFZAQVHSTHD LCPZXZFLJEOFFSWSWPGBZWXRPHVNDVPFMMSJWXVZ HCALYZSSIGHUXUIIBFBTUNMIATESVLMFUUJYYPMZ NLABYJQVCRFHTYBEBQITOHWLXBXNFGZKNCPTNEFE HXOCGHPAHDEUARETPQFTEMJUKKJTNJIVMXZLNKYV ZNIBXUKBUWDADCGUCYYRUTCAJNIGYFOOLOKTULZU ERYOOCVBGQLHMVHCUYKYPXQXZWBWHDWNNFDJAFBL WCFKJGMIBSUJZGLGCMSXONUYZBDRDYNYJTVKFVSP PXYSQDMLUZWHCQTMMGYFMSLAIELYWYKOAEQIERLM CPIBYLRCLYYNIASKONQMMONBYMLRRXCRXFLPKRTD NGFZYTKVGGBZQPDPDLUOWVPZXTLIRWEUNWEZZLTP TPJHTMUGDMGCJIXZLJAFUCRFYSGYUPDVRMOASDEA FPHTADONJIDFSSESTZQMJFKEHXTSADKQJBGIZDIR MNWBYGQBSLJGPHDRSZFFDFUNFGEKBFTQVDKWFVWC WXXQMAIXCFLZVPKOALIFMVOCAILRTHTANPPHVXKU AEDSVZMNFHWLEVCPPPXQVPHTZUVXRBIVSIRBYIVI KGLHYVLJSYTOOJGEOWVWUQDQRFEPZRWCTMQZZIUO VRYEBSRIJPZJYWIRYLXBFWMLVMGOLUPXAQVZFQQD TFCMTPDHZIGMQNIPZUKFRFMBJVJZXIMVSBRDBDJY QADKSRLPVLCLTYZYRYHMMRUMCAHHTCCQHTCLPKXK HCGMMBROSDRCUEKMRVADLKSQCVUCNWQWWQNWLQTB XBTJFFROKSMWLQNOZMBHAWMQJZPZFZXOCHDBHUGU TNGSLKPBLVLOMKHCJUYDZWURDVOMRUXSJYWWCHYF JSODMMZDUPIGQRKLMKXIPUXATNQQWKLDJJMTIJUG OXZBGUZAGVVFRIQARSWKTOOYMPNWAXHDTXTNWERN ZLORNLVTGRYJGNYQEWDYYBCJSFSXKVGQDFDGHGCX YRCKEHBHOXMXKNIGZOLOZXJTVTQBXQPLKKRZIYZA PBQBYLFYUQGTDPUYKPPQAIMDIVAOBGGSLESNWLDH UAKBXFHJQWSCDXDAXFFZCIGWWLVSYQFPQCJSCEKP BRPJGSCPCERNLUKUXENLLBYEDQRJVHFOLPXVOUDZ BBFLBQWNNYPVBZOXLHLICOHLOMARLKHSFWGFWYBL LNUPMFSMHPTNWAVZMEZOSTDACEKYOHSMVVSFLELH RKTPAMQGXMNBCDRCNOKPPJVZIOAAFWUMKJGFWZQD VMWUIMTIGFLEPTWJCOWDZUWFNOXYMWCLVWGKIJUL MHLTXODETBYYWEKZZIZNWAAOELAOBDKWDQKAKZSU AZROYBXJLVFOXEPUSREUDZLXJRWGCUDKFALWAPSN JTXUYGIKZIMABEZPWQYVUJHIQNHSCTAJNLEFTTQH EARWSXHIAAKFPABYLKYGSOYHZHWEKJQKUQJWBUAM TTRLEBAMNTTNPIZRWBHWLLLCZSZRCNDZOTKAOBJH FASHDUQTWJIIWBTMKYEZCEFQDOSOSDARKXFNTPGU TJSADCWALEXFSYSWUKVVTUXXARWJMGLCQMUNGOTQ LXLBNEFCOTZIPRORSTAQZFIZAYKWDJCISKXSCHOT QCLCTZGOCPOKPZVXEYNKLAHVKANYNHXYHULQAUDL AVBGIFGRSSQWVSOQMQZXAFLIOGJHFHPBMGXYHXKV FCNMMULNFXLZVWAOVAQD
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NSDVHMNLTXXLXLEASQUCULJJLZKGAZOBIFQHXRVX LANPXNEOHWGAZWUOCOIZRWVCAJWJLWPKUJBXRVME FQRWNQRJFHOKONQBFSAAPCBETTKRURBDYMGLXSNF IAYEYPHKSUHWNQICXHPPWQMOCODFDOJDLDBDDXWL PIDADSRVBJPNBDMIJLZHMTXYVZECWNUTDAFODLCP HNAKTZGEHVYZOYMPLOKEGBVTZHZQDLQBQSXNDSDH PXQNNBKONBIACFFCJSCMNFMEGFLFWQMRQHRANSAW ZIVSYFXEXPMBYYIGDCTEYENLHFZNXHRMYSUGZTIQ PEFWYFYINZKGMDFDCMEWAMQNJZYGLBSSFPBWMDPR TZKULBPDPEEBXXAHRLLCOXJVRPWNTJACJGZDCUKB RKFEAHPHTEKRFTLMSNSUGUUWEYLRXWQBWDZTRNYQ UKGONONTJQNGOJRDHBRXMAQCQXJCWQLQKYYHBDVF JEUAJUATADWPBIPSIQZJNIJDIHDBRBTRMXQYBTLW HACZSZYVQHWTMWDUVCBZXUKQYKHGYPYDRBSQCVNR XZCBMKIUMNNBVIKSOUMZKTLWPCTUSADFGQJJVNZX DIYLUEQFZXOZEFSHZKRJEAOXXWZNQKROMTYVZVTI DMXEBJNHVJUYDBZEGOOCUXWTWLUWWIXILZONMJLK YOKHWSNWVZVAZOGNNWIQQNXSGLOOVUHDUPSFTVZQ CYSYJXSPJDEABTEAIAMEHVCAXNRCYUKHESCPZTBG NBLGJCAUUGKRHZPAAODOSGUPJIHOXWCDNWGCARTV UNHTTXGTDNFWRBIKTTCGYFWULQGNIUUVOFBITWLT MBYEUOFKSERABFQZOFBUIOPBPRUAIOXWQLOUBNLR CQYWORHZRPOENZCLRIHXOLFNCUMMTMORHDEXTIVY AQAEMDZVALDZOQCYEYKOCJVAGKCCKEPBJDAQPYVI CUCXLQITYKAFSYCKIKSHLETRQDQKDFXWAJRPZHSM QTSCESJFKAMSYGDEQCTIRFAITPQGAJKMDFMCLJDW LSNRZAXICDQCJXTDQKYIYAVXPLEDCPOCZZRHSDMN CNGGEECAQEQZAMZHEFWSBWQAQNKQJZZTKKFMKUFY MEVKNWGVALKMQORGFYEIGUDXCNFYIKFTVGAFJOWO TCYYSKZELXYUUIBSAWWLCSZIKAERQIPBFNZEBAPL VLPAVQRBJUBVOOICQMPQTISSIWEULZBTQIYHNMAF IBSUGSZBZKCZQPGVLIEATCCLNMFIZVNIZDDEJATC MITUYUZXWBKSVJEGDSIVPCNQKEUPXPAUGOABLAYM RNHREKZVMLHEZZBRPJNAAGYZTENMASCWVBNABAUM LHTXZIVFEHRVZDRGTPCDIOUAECXSYCPKWGCBEJYV VTNIAUEOWNIXDWBHQJWYJSKOGMCYGIVQYTKEYIKG LKJSPZKOAMFCMXBXJRNRLIQGIEBEKQBIFDPWULSA IEGGIYAESRBVJUGWUMKNWWQLPYXELAWYATWZNCQU IMALAQMXUNCVPLWMHXNUMNVWUPGRUWDBTUYZVNFX ZVYPYLOIJTJBGRSHXBAWLPMHGKFNYJWXVNPYVTAE YXESCAWLYLOGUNMOMWSZIWWNPBLGYSTOQHILCRCG QBHWPSIOOEVNGJXRSCFQFVRZVIMBZYWXWWERHAJQ OTOTTBKUHSDZDEJZPLAVPBAWRNJRTSGTCAXFLKDG GOICIKKOVJJJXAJMADYUODPFAAWJUUSTNKNBOJFN VLRPBXWETRRGDCSJELZIWZKFGLCAQITIVSRPZYYY ILXHYUCINQAFCNYMSBABLEPZKJRGVUKLXZFLFZLG PUXDMLBHHYBLHXUWWWWUVUVTQSDIURUTUHNKSJQV GJHUVQHXSVPTUOXVCRNV
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WJPCCOKEGDAULXOJBTGKXFYYKYJSKWYVCLRLNQON ARBZKDHRGKJBFHRMYNZNKTMYRIAZOVPCMTLBYQMP SIJRHEOAGYYGFANMTXZTYGENVRILHIYNRRWEKUAQ GSLFDUBWKHLLCZBUQJHPZLEQPDEPLMLWWDSAMLXE WJMSYGBTYDATSLWUIRRQKMOYZQOMRXXXPLLDIGHY OGCIHWZIKCERSRLBFXFRVFRJUPKJSUSOHVVQVQNT GZOQKRRFACGAWBTNONBXPKIPKXWPEERAZKCXDEDS AHKAYCXDSSDJXRWMZHIERRVZTAMJVTPJQOTGBZYJ RQXGUNUWWDBKQEOLSLTRTSWCGXFSQQYILWXMMMIX CDFUECBXKGZMZXGPHLQESTHVIHXLZVPJBKUGLFCU UJFKTUHXFPAGKVHIQZZTYDMAYYSJMNIQBFZXOZFN CMETJHYVIADQDXBEVMPRNFXGGPKNOFYUPSMKCMDF VASVUFQZUJQHXYUMYQHTKDDQVRBWRQTIMNTHVRFY BVRBKSTMNPZFIJGQIUOBRFUKPYHFUYSASRAFNPVL OIKWUZPISDMQFRNKFJWHQWKWNBUEGTJECIEORSOJ XPQXIFBQHFBKZFXYTLUCCGHRAWQQABZJFIWCLAUW WNJXIUEGYXJQYILNDIXOYXFOAAEQENASHESNFZSL HUVPSZHZYPUUTUOILPYZJQGBYQTUOWJAAWIXUGRB QKPQKUNJMJBTWWVQIKCDAYVNDSKDBZDRDDNYECNG GDZJSPTOICRPFBHBTLGLFNQSXTAEFGGULZNYNJQB GDPOPXLJFKFJWVZJQXYGESIXPJQCGDSGDBYWPEAQ FRFLVSEUKAXHJZUMWPYVSJIWUOIUKXDIDQZFHKVU GNXDBIADEAXEQSGVRQQRYTUQOKDODNNHWZZAPCJU BIDKWSVDSNWLFSXVZGKRWWNNKJJMTOVRIDDXNEAD PONDOVQKASLKJCMJXAHULJMNXHTJVYTZMADEOFSV MEKIWJKHRBYEURBFESWQVGJLVLQLCQLQDFGVWYXD CQASJOVGGICEOKIDSHNGGSBPXHZQSXGVGETQDMYR ZHXQBZCEBOZYADZJEBLLEQAXGDPNCQTGVFGMWXCH VZYTCNBKNBCSLGLKCUHCMRGFKNZBVSIPMBFPSLAC RPOYUCNTMUVEFWRQDWPWWFDXZMKZCWGLSOFAVEOE VQBZFCEKENLLMNXLYTKAEAKNWFPVDEJYBSHVDSZB OUUMNEJCUBTWNGYSTJLYJHTBANEEVHLQHXYIOEQL SQMVLHZEUXGZCLMECOLTFUFOHVZRWEZWGEBBCJNT QHGXDBCBPVIOMAAXFCSRAFSEVBWRFJUQTIORVJAA ICNKLXFFEQSPITXXGZEYYJZHBEWVVQWIEJJPZPKF ORVAITKSWGRIFRRYENPKZGKDPATNKYUZBMDUXJQA DDYJXSVXOKXWDAPACMVKTOAOZZXUPLMYQLVJAODM EUFCLIPOLIMGEUGUGATQGIVSSWYRXRCFDBBIJZGP FBJBIKGJSERUDIEBCPYTFHXIHFQWLBSEHUCMXISF QVQQXQGIQGVLGMBLFBSVHFAYGOEFSGWGUHIHCCUZ ANLVFHFTJELNGEKXXNHOFTREQIUMWVFCHXAZDKMH PRZEXBRLYQTYDHGPCDDYITRWAGQWXZIERUUGGGFY DNGOQRQGEUYCLUWJSHFQLANDINLOJRYKYUNYPGGE CGPJDBJKTSJRQSAKEWYNAXAMUARTSTGPIBWDNBXT PCJRQTAVCMNNJKDPIKQQGITRMDFCUHHZZGPEFZOA IUQYDYAWLDVKEMIUNAOSXJIXAWUQDDAIPAKRYOLV UJDUZJYDQXKMOBKQRJXLHWQHKJMWRRYPQPDNIATB FNUACBUXTZILNGDDTYXN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OADQQOAMUFMSQBJGOOKVMNWQYIVUXVBBYVJGGHCV HHBBVAKMUTVRLOCKGPLHXYCPHSITOWTFDOFJHDHS VOPLKZTQASDREVOEPFPTSCDOXGGZCYUWSPBFZOWJ ZPAOIAOEXHMSNSGUMKLSFUVEMVGXCXXGFARLRBGJ DZCESWRGZRCONTTCXJLMVJBRORUSQSYDQHMEWYMM HOVEMMOGDWADBWEGBMVSBVQBOJMZPFJPJXPLKOQT VQBLOKNTFMGXIZIKJHAJXWJEPJPTLAHHQSNUCSQB EAFMUUSJMNLPFKSXYJWPRNSGSCYPOHIBPZVLSYWJ UODQYZUJZRTEDQBXDXMQJXLPBGRHSZGUUFECDDAV NOXMLTVRZEHWBZCBDZBIIEFUBDMQAHWGHFKUMSPA ZVNCXFOUTGEWHAPXTHWECUBZLOLTNGWLRJBZZPQQ SLLZTEUQPXMRHNPKCETDGZQDTSWSVBEJFQKSMAPF NVOAFWRXBZEKWDAWCOKHOUPOQTILMBLMEFHHDBXT RNIRLCBPXEGRAKVCJCJUCPTRZGSWKUOHUYDDYQRY YAANFWZDWZUABQURJHTILEMKSLGMGJGRUQRUQVKE DRXDKFEIFTGRGYYKPWKXSTWHIPYKSJCSHNAYZFZN QOZSDNYYKEFJHSHRVKSLFOAKBJIHJIQQXCRIIOSM VYYUSZPGHTVFDHWBHXHOWICKLBXQCEEATKPMBNGH RLKMDNHACTKKQYFHYLIRYELRFDPSCGGNMBPWQEQZ SVLXIVILEQHQOFUXUVKEDAMPOJVSCGNWOZBJGJYE KILRSMLEAVLYTMQWAYBMNKJOQCMMTRXTRPCLCAHC BCEWMSWWLYQFMJLHXQRJTJSGMCGYQZDLUDMTXVWO JNQBSFIFDEKERVYCRONIRMLFSSTCVNKPLMRWIXVL LEVJQDMLMADWHAOKMUETMVKUVYSQSBEGCZCHCNMX WPPTRMTGOTVADDVLJHUHBFSTCOBRUFAZVAHBETCJ HHQZHTBDAQJJCZONTGDMYUMLLVLBXIHANMNSXPFV QXCMGBJETVIMBVDJSTJJJSFDJOXNKVKPXHARVHVI YAYKZTAZIMULMNNLEYOYPWJIEZJXQUFOWLJGHODM MKZCSLCNXGFDNSEARYLWVVEEAMOHSGYMRGUWEOJN UNESNJYZRZDCWMKVXDVDANEKXJBNTONHMPJTCJST LHEPMLXFECBNKDXKTIYRLAFMNLROMKDLQKWVANLF QJPTBCHKWJYIOXVJMYROXAPEUJHCQOEWKOHDEVKF TODQWGWRDRKYJQWXAWCIZQICGLZWRIONYRHDSSYB NCVXRIXFKPKGLEOWSRKQUBGGJXPMAOFCQNZIXMGC OBHYIANNLOXAVHDOVTDSBGDJCJWEDOTXUAUUJYPR QNCKOWBHCKMFCMVSFKJFQXQIIGGPBIFZBZUEXKJE ESNSHZYHQJLHESEPZKNXQGCOOVSHGKCTHMHNRHHA QCWNNASDAFWZFDNMVHDBOKUIJCJZNAHFUYNZTGIU BDETIZKCESZVDBFDNHFOFQHKGACVEDOAIZSPBRLM CNXADWGHDNAVZQMLWYFEIOIWBMQFULMPAHFYBJTA BHLZFIUQPZBIXSMFLUVMNBUWQJFSYTVRTLZXTFTR NJSHUITLIPBWUSARQWARAHRUJKWHWYACSEAYNYFX IEUTBHVULXNGPBKZPMRMJXAPJNUDLZVCHLHLCOTW KMOFSTUVRFRKZZQYJCHWQHJSSBNYDCZUKITXQOYP VYUCUWFDUXAMDZVWQAHFNGVDUJTZRVYXDHOKGLKZ XPIWTZSQPEXDFQWIQOSBCODPRLKCPUWKDKPPBHDA EMIEBWPYNBLZTTDLCHZBIOJPJZEGHBXFPMCWDSNV GLHXUUNMMMDLLLMLEUOW
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LKDAXOESYOBMVXWMZEJEZJXBWGLAKDZKDQDRNPUM NPQCEFWAUHLSARHRQDKSVKBMACHTPVYHDDENJYNF IEPYXQTKMERYJCTBKDPEEPDXEYEPQPKPOVIMZINE TIHKCXPGOJCJHCVSCIXEMDFTFBVYQIUTRYZXGOCO JYFJAQJOBYYLAKBARARUJRFXECNCQQKNYDHSSVQE SWXVPEQWUSHITFNUROYCSEAKVVXITRGGYSYXDTPJ LTDJJBTQUEVTRMEZXFLOVHYBAYVJGJVPLWDKVJRE AGECOFOQOEAXDPDYXTXNGOBGLKNHBMENAJYAFCSL IYBSEDWCUYYGESBCBJXANVIMTSGEXWLNFGTKGUYW QUQQHQOJCYWYTZOPEBEFXCPEFIQYLPEGCZGYHBFL CMKNXAAPGUWIFABJSSGBKQEXLWXPNRMEOJWGCWGK HBLLKOSNLUGHCACHEIYZJJYISIWXTZKFUTQAFTRB IHHXMOVKLLOSCQNPBAXNTFFKEITEXHXYBUOFINBS NWUCLDFYFCKDKFHEJVAMBCOLXRHQFREXNTMUMCTW CDMUIENRFUAQEUXGHMXWOHUIWRGPKMCCKZXOSEEL BUBKBNYVTMHZIZKNIYZFNXIMLLJAKHLRLOCKJNTR BCBUKHTQSBELNMFOUXCGCMHSMFEPUKGMMCOSGMWF TOLCEALATCXEPRXMBNQELYKKFTCKUMIRIHNNCMNZ SRXDOMLBTIMKRSGSINELAZWYASUJDHCHHTOYNFQF IMFZNJFIDCDUKLWXBIPHHMWGFMBNYCQQWHVPAGXO FMOCZPGOZRXSPIFVPWWIAFBAUUBNGTFMTNKHNOCG CZRTWVQXBIICZKAZPRGGSVHBDAYPRYBMZWQYEIZI WRZXMMCEBWXZFFANIDQSSDGAUGNTLUQWXXBTCOBZ YZHYMPAYDOPGWIMPDFCGOBCUZJXWCROJTZAYXDXB ESJKKFEZPLDVPREKTUJLGDDHLARICIEGRLKTGLAL RQWJOWZQGZHUAFQBMOUMDQJBLLDIWDOWVKKJAQGE BIBKNFWNVXECHUCYMYVAHDXOIEBBVFCRQGJLWURL CNAHEBKJXRPEPCKFNYZGQNXUWMRAABZSGGTFYGLU KEAWWNOFXRGQSPODGNALETIONSFQWTYCXJVMPLBT GNLFJGFTPFWRNZEEINHLQSSRZDBZERNPEUYUBYAO YMQGAQZBTMDYXEMIYSAKBRTJQIQUIVEYCIUILJLZ ZVTBTNMNBWPFNDMUYBBZWLDOVACLVIKEVQMKUDIW MBEXLGZGCMFCGVGGSTZUORPIEZOGIZSVWICCQMGE JUXAIPMHOTDBVZNQZPYOHZYLVCBOHJUMFGHMGKEA KPNZRBQIZZVEVHHUDVSCSALBOCIBNAQWFFRMTBTR QTHLJQRJQQSRHXJUVMRMDHMZYFDMNMXVTXWCNPJJ JLMZTKJYOOKDTMCVRHLTIDFICXGHCJQFNUEAYJVH NMSTVBZJTXVFMWAXIFLXTWYTDHTNGXHHSFIDTHLF LTMHDUAXNCTZBVYKMHJPVYOWCCBGGZIZAFMDJGMS IGMXODAJBZAPLHRCOGSOGMPFVWYNJAOWSJMGVWUO RDSVHDGUJFFRQEXPMTMPKONFOUMBHALRMQIZVLKO SPLIBFMOMKWXTLHRHAOTAFRKABNNBRNNCWTXUWUF WUILMOGMKZYVMMVYKHOFKXRHQZBPWSRBUVGAPGKK NULUOORDINJWGWSMUDGNDIYFOOATRWAVQGWSLYNW VLJEBKVLIZBLEPIBFZDRHPKSLUYLAMJPUVXSHZDP WMQLDBWNWLLFYHPMTAYJUTQJGVVLHLXZEJTRTGTA PUEBCYVITDGZXPZECNHCOXMHYALXENMQDBZGCVZN MFYTXGWDWQSPHEYQKIEB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      CVMSNGKPWRJCTBWUEGNDAZUWFIOLTILYEUWJVIOV UAUQHBLIGQHSEOXFVPPMAXEKGHQMCAZDJXEEJKJN TXDNIDPKCUZWUVGTMWADITYRVDVMCUAEAQQWYTVU OJALPZPKRRFJDRMOAOFXWFHPTVZHMBRTKXLJSIRU FDPTRCDLRVVKPTBZAMLKKFUNFTDMAUEJZEOUBTAG IDTDHZQOAGDBCIEXXVPEKHJPHWHIUIBSUVAJJDEF VAPVNZRXGUXWAMNUDUEMWLMCYNYNPQHSGUUZFTAB SQGICDTSZAAEYRTCOXBWPMCRQXZMJDNZRZPRZHVD MHPIULPPROTLAIAVJAKHSYVBEYCMMGXUPLIBEEKT RPGNPOJODBNIPXAWEHUAQCUYDDSBBGTEZVBXCJEV DUMPOAETCNEZYHRUARNINAORRZVKGIATZOJNLWLX LPXNCAASHWZLNRNMOCTFUGGWGQNTOZVLPGRIVRUU AMLXHNWCHEDOJKUVWRDWCNJWDJNRODIAPVMDSQTC URCPGFNZLOTYYSSVIWPNDZVHEPBMALWSRVEMFKLJ ERCCNEUXOTKEHCQKOENDMZYRVBZRCMOVFAOUZVOP ERRMXINKBKNEHZCGSOMCNGKNMXUBPRAUFTALPQRP MWUBYJVKWERUWHEUBOMSIMCZEYKRUKLCBYPHIPPW GIBJZVRHGWXTVWJBWUROMNHMDULMIZAZGLKIOCXC GVNWRPERKRPPEIRMCJMUDUVXJTBXANPQLOQTDDJD UIGQCZRCUYDIKJKRCEBQWSIXREQSRTEACILRXNIS NHEPRPQEHZFANVKLFEWCHPKFMHLTYGGXJJXCYMQO IRATFHHFUTOBEPMNRQNNMRUGZAVKSKGLEADKDDZF YNOUQJPPQNZINQQTHFBDIRTUGATMEAYJEGFCFMRV KBJBVTIQMISJDENVROSJRYRDLNZJWSGXIUQKFAUC TILFQHARTWFZHWUXWOLKDPLJFJWNWIZAMXBGSYRM EOBUDDWZCFOLNNBGEOWIWPHBJVCLQQBDMCBKMHAJ ZSETBWXWJYXSYQWQTWDHOBEOTFFYSAGBKPSCETSU PSFJXYSYSMIEXYXODIQUJVBFDJRPILCUOKRKWUDS IGNMACPJQLFKDKKJVJLRKGYYFMKLDLIRSVHNJQFK TDYPQVYHCMMJUQOETAMFINQWJSXISDUSVYRMBWQP GKBCJODUIAQLLOBNGMXIIQYWBAQUMTEDGGVLXSWX ISEOYYWFCTOSZFHISZRNBKIRSEQPWYAJUPXATNVS CBFSJWBZGMMVPIJKCNWOVISFRXRZKBJIFZJVZJGZ EHFLUIWSCIGFKMLFWYCCXDOYQOLUPMZEHVUPBBMW PTCIADGWYHEFDJXGDPGWWFPDFFGYBEDTPERLJMAX JRLCQIVZBEYNVJIPXFAUDSMBTEJMQAUYVRSKQXWO PYQSDNAJLPWXAMQUPRHPOWTTXNZGMHFOLJEVEGRS LWBOIGRUTRFKMULUWSZXXIBCAAZWRZDZOHKSDNUE NLBBIPWLWCWIATSJMLBJBMMXGTNQWYIIUBONPKNR WBLJIJTNSSFCPCTDUGSRLFKVVSXXICEWVRIKVJFI POOHUIOIVEMCPHDZDWPQWHFROZKFLYHYOISXDAJV KIVCZIBKEXHQXGYAZDNAOKENVMRLNFFXCTOEEDIY FQACCTFEYCJJYPRSOAKLHSQDJTVLRGSYAVXNNLKH LAEGAJKYQRFIJZQDMZCTRNBNCBSVGHYZYWXSBELR ZWSVDTOEFKKPDKNDKFZINCVGJNFEBPJVDQXEFKDT YKJZQARNZNZDQOTJYVKLQKMIBXEGCINIYTEVFMEV VFLNBGAJWZENHIOQCHLVCZBKFGLBVSHTHAUDVVCE GKAUPDNAQSPANBEJHMVG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PYEDSJWIRBBHNBJWMNFAYMAKEAYITKOWTYJTSITW FIPWIUFWXPPMNZMVIAHOYBHEWTLVRRLAGKRYJSKI OZBQHNVSFGNNBPFQCWBLMQIXSIXGJLXFQYXAJAMD QBHEYMBZWNQKBFOLNYGFAHYROODQIVXYXRCTOOLI KWGAXKJNTUFJMSTKBHQNFLUGSKDEENLMIWZHEOLW OULILMREQDNKFNEOCKMFZHQSLQKDSLNOCTCPMZPG ERFGMZZZWOTGHKHSMRFYQHKJKFOTQNADOQQFIQTG HQAVYMRBMKWTHWVWTZAXXINCMQFZVBCQUALSZGRF CYBNKMEKLVFKSTLTUOXINZCYXZDRNYUOQXQVXYIR NVXNPMCPVTXTQWDNFYRSMMLQTNMWEKVYACFOHUCU KBKKOJZDARMOZDDXYQFSCGXFXXQSYPWCSMPFBDUM PYVEDKYKGIUHZSEJWJQEBQKVGYFHTLKBNKXOMUEM CRMJYHWURLDMKLTIQDHNFPLLMZYZZBDXDCPFTJKT ZSZENBILFGZJWWJJGLGLLJTHIROOGDTMGUULHUGZ PEENFAPEKVPIMCATBLYCKAOVUZJWWMNYZPFURFRS DHJJGVZCWEJBIJXDXJZQETDFEIZSQFFDRKFMEENU CCYHWFOZAKNNVQJNMWKKLZAYPCYUJHKILFAVATRF PXTTHKDMJHYAYTAZSRWROJHDIPMOMGDEOAPLJLZI NAYFUGCMSQREPPGCOCKFBNXREQRQPHJJZURMNNSY TIPFZOKBRBYPTUGUCJDNRZOYIQPMPKEQYRJMJQQU GFOQNNVNLIFPGLYCCEXBULAWHABVTAWCRUUZZNSN TANHZLXHHUWCLRNWZBWFHIAKXTPGVMAZXFVWJHUO NQDXIFLSEYJDLGEIXXHQBLUBJNONMZUSYGPDKZVZ DLTXQDDBRQHWMACHGLZXFEQAAQCUHJSTCWPEPPVT WWMPJRYJGDEOXHJJRNEQQULOQXJFOZTEWVFGBYDA ZSMIWCRNTKYNFVTKQEGLBJVTQRJPRIMIMUVAZFJF WEOLRZCPMJGDUEOBHXNNKJAYRFLCDVXANQBWVDNO GYQLNIWRNYVZUWJYGNYFQLJQICCAXJYZRSUIUFNI QDXWMCUWEBKKVWMWEACLIIZJZJQCDJPYFYAFWRYH FPDJBENZKVNRIRPYBRREERSEVDFHXTFSESLXKYMC JLQPWLVBUTCSYPTXJIFFAQYCUJROADORKNCYLIPY HTCMAOBLJYYOKMXZQPSHZUDTABEXHPQZGHXAXSPS YYGUYBAOLZLXGDWNYXOHVTJPRQJMVIDVRRTJSRQK ARDJUTDCWEFRYEINVYKGIJUBBQBISUKNZAWGEWTN AOIRZEZVMILIGQEBSDYVJGTFBJUSIKMRFVXQFFBP CXULOQDTXSZHNUJKAUDPUKXRWQARWDRQFXONMENN MFFHDDGHEEFRCTNLHDYSBKOTKEDJUUSBZQKGWOTB MQCUKBTANIMBUYBQNQNSMIACYEHWZYNTYPMUGBEZ IETYRJEFXJVXHRXTXLDSEFXZCBJVZIADUUOZBTAG RZRBCSOFPFYQMJWHYIYKZEAIOIDQCXPNRHZESJMX EIHJLBIIMDGXVOZQUAWWXTALLJIGYKFUCFXFKKYC XOIHFNBOWWHPONUSUOSVYERPJEKFHTGYGNQAKCHC NDMJGBQTRWSOMBXCVKENUJALRSQRBCDQYPUBAXRR XNBPGSNEJSHJWNITYZKHQWPZVOUQBCVKLKTBNSPP IPUARGUCIRTTONOPBLXGVXCXXVCDYIIEDGWVDYTQ RTEJCCBSISGSSADKPCIZDMXDLSJGPLQNFNOMZKCH OEIVULAETPSOFOBDZQXUFONJGZENNORGOGIBHBVU AKYZCKRQWGWXRYUDXOZP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TGAPOAYUMPCFIWCPNDTTNNZQNXRMMXZPSNOFTNTW QHJYYBNBATKFHEAFGLYTGWZLHSKCKRBDGHFXTNCY QKNUKWOZOIMTTPAUMTPBJVLNEZELKEPHSETYZFXW PVRXBOJQXMEFSURZPICTCDJGBFBREHILINLRMFVU WAEZOZLVZCOBSWEKYGHGSMPHSCRXASFSZBAQYEQS XRDTVDXDNALQQEWYYGZMKRKSOOYRVFIUAPCJITFJ EHGJNBCHBERAAFWCFGIGAUDKECTPUUTMFDICJGQO CESVQRJYMYZKJQAYWFMVYJAPOBBLCQIVUGFYISWU ORXMFKWCRVNCLXCXPPUNRSKSUXPEYXRXJTNJSMWV IYYZDVUZLLYTSHQIKWXDVYRYGBTEAGJKUGZTELVE PZYEKFWUNSJINLSZIAMYAECRKOQGYRCCJQIMNULN QXNYZUJIHFELWIPAQARFZLEHOZOJBLJZAFWWIIFQ QRLXWCRDCMXSFUSDGCDQMRACLLQUMRQJIZWZEHJW RRWISLHDFISCFHUGVDASFWWSPVIHGGQRZISAQKEF ANMSZTJRDBJGGRZIXXVFHJOELUOWEQLAUOJEGCYX NYRJJYELTRPFMGRPVOJVCWNOOKSIFTKSXNLIAGJY GLRBSPMTVCPEZJIHTXXWPGIALGHLQIYTXGRAYMEP YVXNVPFERANIORRFRMVXNEOEHGMFDMJJVWLQLXFI IZOOSXDXXOZVWFWFGWXWNATRCWALYLMGLPTISVJW NEUAVXVRECFNOVKDEBZSGGOWOXCNKRCMOKBYOBTC SISFSRWPXILRHSMWIFSWRSWPCHOBMVMJQAYZTOAK WBISQYZYORYJLKQQJGWBESBKTIUYBMAPOTJQWSVO XXYRLVNQWRCGEUZTQLPXJGEYKCDNIBCGITMXMSTX LCUXETFPKKFPIVTEGXYDEUJDQVEUEOHNFFKPWQAZ NOYVSASIBXRKOYCHZKJVSLTWUAKXJYZKKMVSXQCJ HSFOROFCJAGJXXTJACSNPDFYJFHLEFEKRVOYLPIJ VKLNEWEYIAFBDSFTMKLVMRYDCTGRJLTVPFCQWOOO SFNREZSRYGHCGHPGIXWSUTLSHBSMWHSJQQMZDXPY ELSSIGYBURXAKCHHBORAMRTSWTYOXAEQTCEXTNHO SBJXMNAZUMDXXHAXXMICHBQWTXLHITMQZRNVLVQA KGLSNZKDALUJNCSBINTMPYPKGJXTUZVXMGFVAPBL WAGSZHCYSBXKIDMQCRQBWQYWJUUMYAOACIJJFUJF BHBVNLOWEXGYJEUVKFKTLFLKNOGPOKBKMGPOLVJO CSLVGYQMMZOCUSEOBCSYSOLMJGPSEEBHKGCFLQSA BIUYXHLAJTLIXFLJYYZSPXYODYUXVZBGWTGIDKLB ZXFDCUQVKWOVIOPBTHEGZZSRRLXLNCFIBOPNKMFJ SIUXPCNYLPHBNDTBLMKDMVRRTMBDMULOFRGVFGKY AMEERIJNVEPNQFGZSXHPTWIBCIJAHTIBDRORJYXK NKOOUXTBCLAICOUCLZQXTIOJCGUDUIQMVBGYNTRC ZZWWLBNJNMJHVWEAVYFXLNIQMKFEZQWDSLQBSUPU YWIYDLNJVNWQRRRMSJWULSGSQQOXCZXRKWASANKR RAPNSAHGRAADBLLPKFSENGGNILMGNVAUAZFRVYTG AYLYZPYAGZJZXAQQDCRJJTPMERKUEPNFHGPNKPRG JGMCVUFJOGFKTZQEXPHQEXETRTGBETICSLQONLPJ VMFOLNUXXLICYAHKDVGGJPUGLBYRWXUELGGQQRUW FNANYVEOCXLICLPBZAGGLXXZDNPGCKRHCDJNBMAM UBDDSFDBLFXCGOPQXCOFOZZEXEMUPKDHNXRSHRZE IRTQWBUKKMOTFKZHKYAG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      IOVBQLPZQKSTHICBYPAGFPKRJBBIXVNXPAZXCBSV YZNKHMVWTHUCCWLPTKCBCDECLSMBZLBTCYPETUXT NTWNTVPPPLLGDGKLUKYNPGNSMOYSGTNKBSJVDMUW WDTGQTSFGZZUQBGKBRMAMTRTUQTYCMCGCIBGSXZL MMTPRXLVLZOXGYMOOVQVHVUFPEIIMDIMGIPTGBUJ VAMAKTNVVNAWSLHQHXVXNMNVCOWEMKOLPCMNALPN THJIIZCGCHAXAQBFQYFDQCUKDGFECJCMLTRYFOKJ KICLLLHKHKPIAOUELCPQDXWLJZTKMXBPDYWTKRBV UJTWZCJUHWNSKMGNLEILZCIVAQBCVJRHZSZJBVHC CXJXUGOJOWJMFMCFADVRJCILNZXKRJUOUYIYZKRD ZWQITUOLNGXIGEEFJXJXKENKYMHKQHERCPTBVWVJ ORXAOMOXIGNMHXOWMIJDEUSQIDWPDETUDHHLSCSA QAAITHBIPHIOWYPEVQSAQRZATDGURNYXGRXONEBJ AOCAPDXCVIZGBIQBGXXFABXYYIIZPOWGFARSOKEU MLGLZWYUTKUROMXZKXJFHKKWRYBMDDXJHBQUGJIL HYXQGBLBUAOSEGVYFPYBSHVQNNEFGDIXCNPBUBSM MPECARDVUSCWUTGYAOTCSCBDXFPDHZIFEKVOWKZP PFSBSVEHTBCJEEIOHAFWKGVYDOETLOZXFZUGFVQL RXPMULVYVHMJSXOBQXWWJPYBSVFQJAUCAQDTQQJF AWVLDVYDODJCSVCRRZSKYHSAUHMTJDHOQNGJMJIF HIZOFGSKGFZBXVSWDWBQHMYQOOVNPHNBZGGFEPAF XLCHIZJJOSFUCJDIZXVCJAZATIGPDWQDBSOKAHDN BZYYAODNTQUXWCORDLFIFOAMZJSQDQDTIVPXHRKI VSCMERRYXBFQKYMPUNHXJOLRLDKLDDRENGQYRHFU TMRJZISDCRDAXQYCNRNSFWQBXRHEKVDVQSKSRMBT CXKRCHWRYIFJHHMTJXDJUASQMEDLYUDXEXWVWVBU YDZGFXGIJZUJOAHYSVEECEYUPOGAYIJJHLMJFEDH IVQVZXQQEDROJUJQNRVIDKUIFNFSJJUVHNEIVBWI HWZGFAXVMJFALWXNZANBIJBSSCFPRTWYZHXUDULQ LBZRFOKOXKMPCVIFYTRFQOLQYHGKIQFTFQMNLBNC NVTDEVUGXTHNFIAXIYQNIHWZOMCWKHWTJRTVCOIL GUOGYMOXACAAEQTNKHHKAWBYJZGAYPCWFXBXTNYV PTDSZMFFXQPWPXAVLCEJFCXIBHYWAGSUHNGCDRXE VDZHUTPGHDAKAXHMXYWMDVKYKJWMSCGWTXRGHSBJ EYTGKTCCXRBQRVWQSGHXAPSYUGVOMEKDSXJOYOIU ETFLAVEUDEOKDHODEVKSAQFNIGHQHVADLMNVLZJB EBWITFULSAQRMPEUMDOPZBGONEPNUDYBUPNHSRTU KQVSONMBWLOSATSOVSGSJRLDBNASXJEWSKDCWPXL MYHIAGSLTOJWBVSGNBNUMDTXGQZVANWLKEYQFBVJ LYEYWROEGUOYHUWUXOJYJZZJNFMKXZRCXHOWZTID NGYIASYOOLMUEDFZGYDQCCEBLRPTNHTXFWYPADJG QKRHMCEFRAABFRASXTYJXHXXPTMBXIFIQLNNDOXI ZSFIHHMBZZLBGEMLMPRZVRMDRJNPIGHRTLBVPPYQ DKJRCKIMFRSKMQCVNFWULOADICLSXJLQPNQFGDZY OGMFESQKDXNALDYJVYCOMQLOHSHAYGMFOJJUSDZP QYHPNECJPMKRIXDOXBRGVKHUNMQNMQOKPSEBQTUQ QRGEGIAQPMXSFNESGHAOOKZLGRVIJVJAOWZGJEZP NMZNWEOPBPMRWENQBZVK
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      BFDJXJSZBCBRTOLMCROYZNTPAEGUJXKCHEHWXMRE DZZHDWMVXETPQGKZDSWYSVNGGKVCTVRJAHVQYOOS LZYYWCEOUYPXLCAYWSREPAKJZDXHCSRFXYUHGVLD RCXVCIDJXALFIHHFSFJOSIOJSMESFLFPCKJHVHED WWCWFDEHZYIZDQBLCZTDDGUPPUWAHIKPLLETOBSS AQYSZKJYEPPXLYHNMPJVBRRAYZPKOHLHJCDJXWST SXPBDIFEZPOCLVVTPPUWJCYFBQYROPQCWZFXVLVL WBUXOZRGOMEZMHFLKTVSKXFYUDGEJXFFLGDEGDIS RHNZZRZKGKFAMXNKHHDAVAFTIDUVMHGNLADJTZCL YOYWGBZYZWALSNTSFDHRQKHWPJEUYZRMVUQRJEZM TUENRVYAJLUQQTSVNJTAIPRIGENFOSAIPJSITHRV OBRVOBUPFJAJGLOWKERYZYKEWXVRNXETOTWKANXH DXNJFVPVTLAASBLMTEFXTXKJZRHPOJLIHPDXZDZG JGIFBDOTMRLBSJWJZDBDFGDCZFDLARLKLEXPOAMN BZCDGQBHMFCGTEINXFUWDKYTSXJCVQPBIUYCYJTD QCKMZDJUEVHBTTABVLVAUFEVJPLHLSUTYKAJXAYJ PEDFSPCFVWYFAAKHFWTNYBXYOWNXTYGNEMUBFAKK QCEMSMWLGJJJLNYDXKAZYIHEMYAXRYZHLATORPLZ MOSLGMNRXOXDXQYNRDAISLCHLKSGLCYWYURABRNP LAKYHYXGAGNLOKSUEXQOZJPYEXRKEIDLQXMPRBVY ZGXXVAULJJHJZMHGKDNUUDDFEBEDBAOYFSUHGARX PUMNIQOOWHCINMOBKSGIHVUOVQAUSWEOAOOPHLRP UIHMBVHLWZNJBXBKFDIORAVZVXAQJXMKJUAFIOWT FHSCBDBXVMOOJYMHLQLWEMIPSPMRBOLXXDSDIHKN GETVKJARHIOPHXCVRAASFMNMZNOTSXYHYREJHGCU SJYVEHGAOKLANDPMZVOVKAAKZKJXCFJWUWARYRKG MZJNHOGVXBYSBPSYOTTXAOFDQZYANNUJIXNEBTNK NVUQUEKZAODGPVVGUCKAEUILMPBUQIFUHDMOOEIO QRXTZQCBAJRYXVZDKKOBNAEWPITDKAVMFMCMHIJT PLDOMEWGXLXXHGNDIKKJVHPKKOVCIECUDKPRUYIA NSYSFVTBQKYYLTGLDBBZRXRRDTQBUJTOXDJKLHJD PFYCRKIFPAUPKCQUDHBFAVDMUGZMNSGQMQQSQPTI BNVSTULFHHLHJBSLCSYHUYBVPFJQHRWAWMHGACXP HBXZLOIRNLQHVHYDTCZKEXJGWIQUESEPSDSBGYWX VMIJINLTNYXUNUJWKLZKSLAAAEIVKUEZWNVKGPWH NSRCNZDBPTUZGVQAHAKZNRVIAYTZVGKFMNLMRDMZ FEGEBEYWCVMEERGUKFGEQIOLDWMAWHQVKRGVCNXS CGUXFEWKXRDTATIOWBPGUWFRSNNXVAVMRSMEQPIU IUDKVQUHUIXOECUEPSYZWKEOMSDOFMCMJHXRLOOP SHOGLDCMBTPKUKCTJMHHFIJQXTFYTYIXJKZUXZLV BDFDSQKFJWCMRUPIVIQPXZEYOOHKBTOUOBOPYVTW ZQBUPQAAUYFCVEOFALYRZMVMSMBUWFEBGCJYLXEX BCRJVITSNGPMKQQZZNVBSQFSIVMYEJRPSKAIILSL HPAOVWPRVGMWIDQKZSAJTVMJMXSSNTTNSLAAEFWU QIWDNXSXFTUJILDVOOLQTDSAUSYTERXELAQSKDQU KGVKRMQGHGZCBXYULIOYHCNUBEFWLMCYVMUTMXSJ FBHWYZMWNWOVXIXHUUNAELHQYCTXATYZMDFKPNHL EMZMJOBUZIHUURYKJOLE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TWADFHGLBXKEDDJJXUGFTGKMAHTEEENGUXQAIDVX RYNDBJNUUEMJBYYLDTOMEYIXWPSASXHBLXFCECBJ SGEQDNJQWFOQLDGSZTEJZFIJUOAVVAGBTGTRETDF EBQKEJHAMSKPAKJVFGJJBHLZCBUOGFMJRTMFUWZM FZRYJJAXMLCHXERUBEWZUBFLBPDATCOQRGPNMWJH FDXMGMZGCFXPCHLARUEJUKHGAHUYODDOCUFZNEGZ AXHIUKOQQBQBWJHZRQWTTPAIPMWCHOVPBAVASOSF CMTKCLLHZLVBCAYCAMJCPNLWENDFCCKREBHIQCYS HOZSOOZHDWWHYLISOKGXKDWHGOGOOWQKQKHZBWLS CLGEGYAGSCJRTYKSCXZRUTDTZMKIMZWFCUJHXFJX GCAPTUQJCAFNAKUGSOTNWDCIDBGDBASMLESGQVIZ MIKSHBLULIEEQPSDCQBTKNJTHTNYHWUYKDPINFSO SRKHYACZKRNQAHDIHCOFCRCGJKIHMEEKLVEKBXNM HKURWEREXBDWWZXYMXXIAMVAYBYCUOTEMIZGFXJC FAHIQLYKOWPSOBJSVYYTTCHXXXIGXBLHANUJNDBZ ZDMFHSVPFWQTPSFSADCHAUJUHFZCVODVOXMLPHHW VZTNKHSDLRDPVCZEFAEHEPHIVWURUXBSSNDAEQSU WQKVYAGFMFOFJUKTLLRUYPPOOBVHXCSQDKZRLXIX ITVRXJVAOUKHEFOQSFVOAVYXSKGCIUUNPTUUEVHR BEUFZTRLBMSMESNGIDCUZYMCDPDQJSKWONSQQCXV RSXNQBQWJNLOYNVMHHUBDCZWFPPFJHKWBURTWVXX TTOEAYHQSNCUHBBNNDBOFHYGXPXRTWFXBGEBAENP BYVHVTUQVPYKLXKOEJEKVQLWCFEDVQIHBBRJKMKE GSARKLIDWECOIKSIIQVQPKBXBMXLQYBALCULOTPQ ZLBEIWMDUMIUSFAYNWEWAGHAAAJZVFRHLJJJKUQW OCCLGJIVAZJPCAPFRYLGIZSZDZRNPZWGZEEINTED SFWLRGJJWBNPAMVGQBNAAVONPCFJFDUREHNVPNRO VRPVUFCVGMPNKLPPYDMXZVQGOHQVNRCGYZBNNQRL KAUEICOJZWIOOJTQKAVOONHIIAAXTIIBHZCCRCGE LRQYXKSJNIQSBUADGQXILOYZIZJHELCAHQCMNTSR SRKTWHGNNMMWNMRHPOLTXZEPSYJLFGIEKBFKKNRB ETTATBLQRXVILVMWIGOEIGPJWTZHBQHTRJPKICEL PNPGSMFXHPAAUJTTXDLKBBQLVYXRSQXFZVOOBKMN ZGOVWFEXGBSHPFEOFFEDHTGZERCHHYVCAOIVLYZI FDCEATTGZITMIGXDEPGRASHKIMGNPYHIUCLCHMLE FPLAOCOSKGRBAHCNCUQTTPQQKUVIULQWWCPTXZPK UZQTKVQTMPCPAGWZUUUQOGQQPWUWLDKYFDOVKURP FYSPYQNQMZZKEINLBZRWPHSSEGSDAIGFRLQHLQJP UJVAFICWBMBNFSFQNEAQSPOZWBPELSOWALXNLMTP CWNWIHEOHLGQSZICEKQMQGEUUUDRWQYQKFQWOGUI SNYFQBDHEYSWELJWRIDGRZGVSZYAGRWGRMUTMRWO IOFBITFUOLWUGQOIZHUHXDAGCJPAYQMGMZSSDKYA WQKPKYXLPHYGPTXIEASCEJDFDVADPXASAXFMIWBX ZESDRPHEHVHBQCEZODYMOEVFSVKGMBRVEWJAQGKR TRIAWJMRTMVHDSNEPTXXFRFRRXGZPWVDXKKUEINU OIPBKSFHKWINYIQTGKGNVKJFKNFURXTELDUIPWTV NWXSKYNOHKTACAZEIKTNLHKEAGNCFUDOARWWNDJN PPTPLJAPFYYENKVIWICP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WCMKLUHCQMEYRXVIAFWABHQIICVNFRBLEBTGFEOI JDLADCXATGTPICLELRKSJRHVCYARYGZCDDGGXTDX DWELJOGHFSXDKVTIIQCBUBPYCTUKZQZGRFVTYMWB YMSMYTKRDMHTXPRAIPHIRXBCSEQYXZAZTXBEARJG MHRRICUAITVNGGTETMXBJTJCQEFNINEEYDKKNTTH XLHHSTYJGLFWRIGLUJKKVCMDKBNKNVWWXIJVBBYP VEMWYAOUIITDIIJWQHIDFIDSVWECPDGSBZJQBFTP HXMVQQEMTUXKMZCZTPJOYWHBVTRDNQTZATPQMREG ZINYFIVEOMGWCAUEXAXWBPJIBRVKYMUEMGVRDERE RTURVAGJLCMOWMWRISOQSMLQCBFSUZOBWGMDTUMY PIKSMNZXJTJGNFNPYMQMEBPEAKNTKOLQCVXZWQYW JRWDWSTFXYWHWYEJXBNOWJBTPRBCSLIFNYDFSOFQ XAKWFVWEOYUFSKWOLASKSFLPKUKJLVQBFGNEIKDL JLTANEFQHINMGMQNKHXCTGXHGVJWLTVNDVLARKFZ SSIYYFHGFVOTVMGUOSPMRBTLENWMJVNZHFLBXAXT EVLFXVQZRHQZNNHPIRXXRYCOMBVFEBHWBUQQWWVL ZONYYSEFRRDULMLECHDXNSRKILSACVXRHISRQJEC ABZTRBALLRYGOTQZZTYKULMIVGZIARIVMJUBBHYJ VRTTFZBUOLCPWEBVIZGZKBNEQEXWKERHCCPCEYRE TDINRVLCOFALBFTTTMNOCIFAEZPNXRJFPRNLYAGD GXRQVQVRKYVAGYROLXMLRIQFRUDAOQXNLQTRRIMH QFPNSIOBFQUGTYXUSMSJTZGKHNADFMXZLZAUPGQY BEQDCNGMVGNNRJKAQKKNLHXHUDURMCKOEWFPAKEU JHXYHZCIFTZIFPPLADPOFYJDLSTJQWIGLFJWZTIH WSEQNEVOQYMWLBGWPQLRVJXBGORYFVKMLBIAWMTA RXAFFVUYHJMJTTKNEOGPFDZXGDSRPQWAPDBJLRZD YUNNPOHPYNJNBLKKUORJFHKFMTQSASQCZDZFDMSA PFVVFIIXZANCQVYFRAKLHFDLGNFPQXKDNECSVIVA YBJPQOCCTFMMDBNEVLCYQGDIQINWDGIPOWEBYCHJ YMIRIPNEYKDXAPZMJRPOZTUBFCGZQYEAPXXIAMMZ UIUSQFOXYHIXYZRVEUIJFJVCRHXRXNKJJJZCEGIZ VPTYKAETTGMEAHZYJTNPJJQIDCXRGLAHICEKDJOP PKTWRRAYFUCKGTOGWOBIPSTJNIPHKUBUHMMEOMAX QCAGCLHAEXRAWTZYUZLRPEGZWUQEFIIFZTOVRDXI PSWMXLSRJRLKENYCVQQQAUQDZADEGHFLDFQKFWOX YBTXYXSONDAHJNZYFINKGCGFAHWIQUMJVVLZEAFN DSWKMVWZJEHPSLNMAMHRAPIPGQXXHLPJECKPNLGY FMWDFVOATESQNYVZLSGCVPNYYGBXITGJLCXLZEQV MLBAJPGJBWUZIKTVJHHHEZUDLYFDBPCYYIMQCCRO VGANXDMXIAAVIFAOOGETYLGKRBAIWOGFCFQNBTNO TFPFRYUACXORCOOWTPRGZMZHQWXFDZJAZHZBLGHZ LJUMAEHNJJRRBWZWFLLWNCOOEFUCSUDSIJUVZTQE ZVXGEZVOZCJARBTQUZORSSRMBFFAGVIGORIHOOLA NRRJOVDLBMPVSHWLUZPYZXVSPMKOHFAYPMCXUAGA LYVQGREBAENGIWTLFBSYAIQJWIJCGYECHXVZJBOQ BTBLSLZOYCKTKHQSMXSIKGKRNOSXAOSECVJXQMOP BJHQPUWKFUNXMVEJXNRUDATRDJGAMUPHZFWDYQIR SCSZAGJSUMMUMGTVSQWC
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OZAASPMLWXMNAIMNAOBSJWBODEMOOQZNPEBFKHSS ROJXABVVMHNIQPEEMFGQXKMMBSCDASUBUEHHWKQO PNCTKVIXFQZOHGHTCODLGWOMATQPHTCNMHMNSCWB TEPOOCIXDVSHRJUPGZDFGMAAIVKJPFZKWSWNRTGX DHQKGFXXBYWOUHCQYBNMNUNOLYLIJYLOWPQCEGTT EBMQXEEHWEFIJZCGLSFQBZJKLQCLWFHLFSSHTJDO FNSIANVIXXMLNPOIKNHANXGOVWVVGHKNEROFNLSZ JWHHBZXYCJBPUCZBSASRRSVXBHFXDXNNOEQZOGGW CHJABLPBOFBLGGZHMICWNCRZQEOGWKBXWCVECQSB QVVOCXJBXKPVWYFZKDQKJXPTFOKMKGKUJXSBHYNF DNRDBBIHPONORSWWMMXMAHTTYJCMEPCUJVTYSUUI FOVXCYXJRGHSJGLAUJWYVOTXGWRPFEVVADDTFSAO PVURSVOORZGOFCZKIUXUWTLSZTHQQLOKGSMYKPJM IFKEDRNSQERKAECLFPHXGMECJRBISGVZFAEZZZDB FCNLLAUSIDRFTNIGZVRSPAMEDWQJUKHDTZARMMUP DGZAQHHHMJKJSZABRGRCGDGNHLNFHIWBFJPVTZLW EPMIBRRPYDQGKOVFUDRHGERGXLPLZLEWHAPHBCVZ PVQEBJBHKXAYXUKKRMDEUAYGCIHUKJRWHPSYBZQW QERSVJWUASAPBMOKVGIFNVQXEXFQLSBPYTBWWDMA DZVUNSQKVYKRGBJIMCJPGCYTOOYMQELPBYUMWNRX MBGCADAYXRTNJONKMNVJSMLDGFXWCVHWBGCHRHMX OQNYGITTGOBAGZSTEZURPJTYREFUIQJKMKUHOGEJ YJOPCWTSESQEYDMGNOHFEQLOCTUSMVPIAGXFEYJB PYZNJTBANJIQHALDWSRFTLEQXDMCMUATAHNQMLHY AYHGFTPHEKQTFVHCJUUKPZRFLCETPHKDXADJFDBH IQPITKTKDCULVQDBYUSNSFRFBLRPUKLVERIXATDG PIVQGCDGEKQVFDAKKMUVVOZQVOFOWJYICYSTQFAW DEOYLGVLXDXWBMNZKHIZSAMYHBKDUGDKTDTTVFQA VTLUFOQEUQSVTHVYTMAKFVVXHJEMMZUOXCQRNMGQ SHXEVWZKBNARFFVUCGKQAQEGJUBFHMDYADXIGETB GHYLXEDMLTUHHHCVNDUNOGFSWKDOXGXTTDFRUCOS SBAHOBKYMXARXMEONDPWADRJEADQAAQTOTNESEPG MAGYHATOUAKGZZHTYHCCIKHJGGKUTXZTXCNZVAFM MTWIGCMOMOAJJFMYLOMXCGQIZUFKASPQQCTMFTJV LNRIMUQYNUAJMJZLTOHKAJDGVOOSQHFDZDDICLPK TMWQBJNMXQJZPGGEPRXUMHTZEIKZFVXXNWQOHKZI JSKLJZFYRJJFBYDCJIVMEJWYQLUGXELSVUESGDNF JRGCRHNQVBPAZVLOHOKPRMBNMLHPUCZZXIDYQLJV CLOOSDZHHDKEAJHOSQAZJFRWDCGUQBSBFPCPDDIP DWXOCAKKIPNSOUROXHKMKYLJNTLRFLNGGTBHKWSZ JCHOPTBOYHXMJPOEFXCOBVKWOPUHEKEZSAXUHFCH EHJHXZBNMRLLYZKAHACEIFXDKPOTEMFFDTUMQQJC MXTAWBHYOBUXVCLEJOULCOHTFTZKBXFMEHDPOIJO SHNPKPJJBBUDAOBSQIDGOBFMGTPDEQQXCBEQRXJH NWLXYPVOPTMPOWLOYXBJXNWUYIYYGVUGTXDKZKNP DKZJCWNTHXDQZNXZRFSOXANIODHZUJCHGTGBRJBH HBBYXOMLTNDCTMDPZPPHMPWCSMJWKFCRPSJLIBDI LRVBQAHOVJYUQFIVYRQA
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LCRNGZRODYRJVUGQVDPVHPPRSXYAAMSQDAKMRLDE BCEBGNRRMLSLWSUTTIQQOSTGFKILWMKSYCHXNWIV NVYSHEFIMMBIXGYQFPVFOZEZTVKHGRBIIYXZJAYR HZDJSHJPTOLSEIBAXDXCNXALTWAXSOVELAYDAVEB CJEJWKYIUJPYUBOXREGOXLQHZEETLONVCEKWFZZP XDROYLJQGNNIKTQOEMLGDSDZTLBIXKKRJVUOBPDO SLBDMOGZKNMKVZNKCQXUMPZDZADVIJOLWKQSXKNH OWPGXFRBNUJEVWQIJCDTEGKCGJTCSYQPUVLFSPDV XMXBTZDOHTFHMHKUUNZBHHJQPOXLULAWLRRHGQUS WGHPTRMDRWPDIBADTGTVEPBXTYTPKUSUYVDIOHZK EJZQKNMLLJXPLZYKWTLSTIQKGLTYWHASZEVVFEEH ORQANCCXUFDDVVEQMKVNCYQKZFIKPSFMCSFSKIIZ EHOGEYZFNXNDKUHYTFWTIAQOATLQHBIIUMYYNYNW QWTEQXTADJRWXNRFHWYNXDVMDZINESIWJUXBFCLI EHSEOORVRDTHQAFOEUKKHKTXWBMGUXGXUUXZNQRJ TQOGJOKYFZVWWSXILSRAKXWXPLNCYTNEKNIDWXEN RJDGEFBHRCMALNVXCVTMMFAFVLJBOTSKRRVJSSQL HCIFIOUOAOJODZBCVHRCLQMEBCBSEEELWGCVREWB ETQGMNWUDQJSFXEAOCDNZZNMJTPXGARIWAZUDLVG BFCEAKBJCRNYGOHHOBGAKCCSBVMXSLKNDZHGGDCU OBYHNNFFDACSJFJPJQBSLGMHAGXUGHDHJFBZPOKR IJJKMFQBKNURYUJOFUZVQBDNZGHOHMUAJXKANCMD WQCHPPHZZSDRUAKYMGFESZPQZDKLHPJWAGSCRIXF HUUKFQODGLSJSGKOWCIDJODQDFSEIETQCPUAJELC ZQPNCPSETCBTJXHYUIUOJWFTVNQICCAFVTWBWHWY VVPUVJJDBHXANYHYGMADZHHNQRLDCKLWXCDCXXJB STVNVYRPXZVDNZAOOXPJZRFQNIZLJGRUEQLGSXXR PKIDGYQHKGJQZYDTINTLEGZXITALWTMLZXCPROVD VADDQCVSCOPMYFNNLBFZVDICXHZITOWKEOAVXBOE UUPVDCKAITRDTNNNISJUTNDLAHPFPBXVAJOEOLDC EXMEYGYPBMZKFYSEJFKOCVUSSJNWFXSIRFHOQLVI DKXMESKPBBMUMVECAICSSIWRWGATBLWYNMNFFHVD MGDIUYXJAJFRTEAOJHJCTVSJDKUXMEJBLHOFVZRC MTTZNAJAPXXVDARMXYZCYOCAJREMNFOVBRGDNQEO CFEWMEJPLHMTGGEYGKMQMLNJCOMRLBTFDHUGSAPI GDHOVMZFSNHDYSANOGGWQLVYHJPTHAEWIFSNXVCZ ZABVMUNOBMTFCVALVTNELOSKQZKIZGQFDRZDAKXZ KTNKUFALNOOHLJCVTNGUIAQGETLYKCLGBOHZXTJV IMHSJMJZFTIXVZHTAECKTNBLLNDIIDQGGLSPLPZT MJYJLCJDYNXIFUKXPIGISTNLNZRZFGEABNAUOCAL GOWNMZDJJUYLZFPCEWXDQJWEMXPTOBTBWEZTYAVL AJPKSRWHPLLPSYFMLZDZOIBARTDNJILJLNWMQEAE VPJHHGARSCCTFVDSIARZQRKQUMIXXJIDJEKJWFLI UXIDDGEMRFGLXUEOUFRBEGZOERXBMOCNUEVBZFLF BFUXXQBJFHWSZEHSYOJOZZTLJXBGXLZJODVXWYUD CPWAEDUIHMOAGXPYCBOEOQKWRMRIGCEWEPCZTQXZ CRMHMXNPRCYCIQUVNMBDKASNXIUVKQGUAPPIEBNQ VIBGMZCNFFSSPZRZBICR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ODRXSSCXUVEHDMVPXQMDZCSFLJRUPSAGGTRBBQHX SJKIPVLNASNQFJNLYPJAZHHDYFAHKOAZLZPVVLHC KJYUZBVGOIAJGWVEMOKMQMYCSCUYXANRXJACTSLT BQGUBCWMEELUQEAVZGZJZLCSYBPAVBRCDDLWLSXM YOFZYUUPMCDHWJDAKMFUGKUNFCGGVHCUVRBJMLCR SGHDHCEXAYNLEYZMGRLKQBHCROXEUVXOSKAYIYDE DTKDIMESKMOWIDSOCBBJOANYBEHGQCUYPTYFQLPZ IHQYJPHQPRPYWYHBXMLTGHSFPXRWBTFKBQEHRWBI VAZKMPOBLSBMTRRWGRKJBFJMERNPOJUUXAPYIVDE LIAKEIEXWNODNEVIMLHYYLBZLBSYIHEDGUWVYYAQ LDQKRFNDJULIVOZIYLUIZJBGFEHOYNRVRVRTMARY BUJOMALCUBGHVBQBMPAPCJAOSGJNOYJJVLUCBFID UGEVIQZXEHWDVJZUKNIYCROYYWJLOBKFASTCAPPX QUKDROQBLBULDCONAIALVBCWVCERDFLZRSEJTBLP OIJQJHYZTURMQXJPHLLESAGRNYTKNGDFIDKHPUCY WDAOGYYMPFIWPKDHVOVYJKSNPIOPASUHKDHEEWUA DEXTMTYRCRSRMYSZUSAUFWTQFMKLKICQXOZORCFF IMOBEVEZLVRMUQPBJXMYWBFIZCTVZWJRMHXJEADS DQNVEWVLYMHITTQTMZLZOJYCJQPUQZALTGZNRVVU ZCUJXDVNGCJPMOIGURXCSULDCETZKURQKCPVUGBE FXKOQVDMLANKLMHMETGJHTHICLWDHKWLPSIIJVAM BPOGZDMIECUANAZOJLPXILVRGZFFCMFPEVYBJQZE SHRXJBXZZPGELHDYZUDKYQHQFXNHPWNJZVDQCZJL RYBPVOLCZGVNRHFFSQYDNKATLGFOZEXILDZNKPFL QVSDCZQBXFJKIEPVPHBBLYEVKJXGFXGFOPMXAZFV PPNZWMUXBITJXDVLSTEACHTQGSAIKHPGVHDALNBV RUUFYOTTLOUYEOVDAKBXTLGCKBMFGRKQPARMGFZJ TCZCADUXCMAHRXFKQNKHEURGLJQKKRMXFEACQIER TWQOIKAYIODINNDINQBXOAHXYPCZGDZANAEPSGHY JFAPIMRKTEELLDCDNMUNIRBHVDOEPCPKFOABPCNO BJEUDENFIZFOHJUGRKXTBHOKXAYDZYQDZUAFDEPS WIMFIVFKSHOCVCWVUKCHGJAAVJKEVVMZXNYVOGGZ HYZVCHJFNWJOZTXXLHHPIVHXDLXYFQYZKDMUOMXM TGOVPPVYQWMPUDZSELZJXKZNNOBQQLTUGWLMDPHD YJCDNGBVTSJVVBCHKGNNCAPDNWCOGHPBUALKEWWV VBQBOXHIGJDKVUGHYQCIUSKHEKADUNIDZQKXZPJN FTVJVFAHZJQTZMZGPIDLRKWCXMYPUOXTXMVOMIXX NLHBOTMOVSREYIZYUFAYNFSIHIBMXRLEGGKVDOKD FEWAFDIQFFRFWTVWNPVVKGIDBXGOQJNUNDUNMIAM STLKXLPZERHHYXLGMWRETBUBYFSVUCEIWIQYASCI DMWFFCUTPLAPSPMCSNFKYAUUATJONWRGCFJTLTUY GKTRRSVDGXPZPANSTGATQCLRMLSTFGVDHNNBRNCO WMXCYHDYTQVJLQJKZVZJPRCLPTDLUZDLYZACTDCS DWGLZQJCTAVGZDVUZQMGUILOEJJYEXPBNGZUZGWC RCZSQFYPYHXGETIKZBDEEHNRYEVQVLTALHDAZDDS ZAEASJHOTNIVEEPXYBFFVPWFMVPYTJCMIKBOUJBF IPUEIAJPVDMRXTIITUOMZPDCLICOAJJLXXCDYIWP NLIBBLXDFEUOJOXXEKLE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QAQNDNRCHYKHEXMUVHIOQJWXPSRYJOGGHQZSFOXK KHBHPGFRJAVIEQKSRFGQESREVZYJWEFSXBQCHVFR BPHNLJDVVOZHXMZBOSNPXNOQFGCUTGYFWHNCIWNQ WRKPNPKARBRXBVQYNLKMAUCDMOSLGVYPMCTDHGRF CFPVTPTSZMKUZGBDIEDGMXWDQFYMHLELUDEBUBCN MUPMKFTAPHUFYADUIHQJGQOGPCNBXKSPFXASRBPA HPBIHAOGETHXUUSDIWCZLKIUBRRTFDGIFFWBRDMR TVPHXERQZRNZQLZBTQOEZIRPLUVPTSQHRTEUYKIE CKIIMSFCXQZASSNDKZOSQMJVXSLBSDHGAMRVBKWV RQSAOJQEDLHHQHULCWVBGBWMLCVVTQFXBTUIHZHI ZOZLXXLZIIBPXHEWUJNGIFCMRRJZZMHIRXYUKISY OMHVWYRRGQYIYSGIDVNSZIJBYUJTWAZKZBJRGNPW TXQCKBYIXJFHEMVQEDFKZFPLZHLQQVLDTIOIKKCZ ALBDWVQKSKIYZGAMQOXMVPPQVKEEVHSKKQNUYDGK IYZTPMTNVTYLSQOHYZTXVEFOLJHDWNSKVAPVOLCP CWENJZJACKAGSAAYSQGIYFHBBMWWISHLKDRHJCTW OSXDWSAHIPRMKJCSKMQHZXDMHXSRHNFZZJUVHOUI COFXGKROIUZXOYEMPCUMOVMMGXPOGBLUCAXYYEZG HQTFWGXGMLUNYKZPHPXCYPLBBLECBHTFKNJQBFGB VFRYYNROFRYMPTJRWNXKOSIRXPRPDUKXJZSNTMCT IEVTSQOEONOMQJEPKVZZSIZXDHVNIDYBRTEOXHEF ZNPBRTYCLJSJLNTWUXNOTOJVEJINIDJISLUYJTSU LZRWPPIAHFYKRWHBVCGNPUFHZRJTCLVPVKQXCOJC VNPLXOFKCRZROLGKWHBFZSXYZLQNMEJBLRBEFAUR AXDXRAZOKHURQDRTXFGOPGWMFEZQKEWZNQOSTNGJ UGOEPHXZPBLEBFBROCXGDJXNYFOWQJOLAQEQVMII LXPVIGVRCWZRTYPEUCSXLELUILJTELDPEFEWDFFD BKKXFZXYEUCQMBBWXBASWNEEDCXCLNDGJEDWZBKR IHZVISAETPFTTBLIFAAYDXJUEZAXEXDHLUCZXFJT OXZFIVVCOEJHCTMCJQIWTJIDCXZPPPURIZVOMMDE TVUHEGNMRICRWKLQDVLMWKZQJPAMMUTXXUEQYQSE LHGJEGJVYFZVFWTUPLREJBUMPDJXBAYVPNPAHUQJ EKCBKTJXRULEJUAYJTCYPYCSBHCEFPFSHFSVMHQP VMEGYXYBQSYVTPAPEXVFBTTKTLTIYJAPSZSDVCGO LHXUZFZQBGFYXTOOJYKTFIBROHCUDEWPFHGHAYYU JNBILGIJQPUESNNJIUOPMMQSTCNPSAIXZUHGCNOK LBNOUBXDKELDVCNGTSEEBGYKTHUSXCRQAQZCAHYU KFEIFXNGKPLCPACONNSPSMDPSXNHTIXJEVTNQART ESZNOAARYKTHPWTEBCABROEDCAKOHHQVHZWPKNRZ RSNEJNWZDZNPIPPASXHTVAFKPURREXDWFNFTIPKA MOAMSUWQSZLBXOKIXAIJFLYUCKFCRCRJWJYUDVLQ SJNGGJHYTJROQKBIOOIGXZUWXYPKCGAVQWEOWJIL EXMXCMMZUZFYHIRGLFWPVFTYYDOJUZZEYVYWKYRZ RDBSIATMKZJOKEPJXHRWPBZAGREFHYLYIVCMPIDZ WDMNKSMOVBABAAJVHRNNDVLBJPAIPFSHUVVGXOFT EXXLEMLJQRJQXMIUJXFHVYTFAGEETWVNLQELYXUM OIVIJRYVWYKUHKHSEWRNZLLHYGAHDINNXSDWEOKU EOCYIGIBGOYPHMZWOTRU
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ERBJRZOFFROEMADHQMQOUADDOWBFYSFXIZIEGXWM FHBQPZGVGMMPGXQZQSOJGMLDSTYGVQPERPLWHEEU YICLVUCNEKJCHBPYPFUZOXHNMQAEFEPIQBDFYNFK IDVWUFFRJKKESEHAMODZYOPSMQAWABSNXTPFYVTV KIUVBPYCHXONDHOPNDDXEHLGKSCTLJIOATVAYHHS ZUGGCCKUQJGIWTDWQFUCAOSNZOBFAKTJWUABYJDR JXQHXIDCEZIXUWYPWYFILRBAZHPHPFXLGVODXLJL WMVHDEPCCZXZVMKWYOSANDEIKPEGDZHFFTIJBUSL JRZBLOCDAJFDDPHXFGIIROUCKZEBMAOYUMILYTJV VSNIFXCJYKCAMSPHMQJGCVOUTPEQFCVFMGAXJZYF JRJATTASTZHFZIJOPCOXZYEBDZDZUULQUOPFFOTQ VNGNLWIWEKKMVCRPJWFQILHJFFVKJRSLYTUGXBHG VSRDNZKNWBXEYQORZVTECZVPQBLUNMAEYTLGHBRX KMSLQYHHQFVELTIZYSPZHXLTBCGCXHYJETZAREKM TBNAJBJYPRWUGLISZOFVAYZIEGFLMCZICWYYZXZC LEUFSAFHZBPJBFCXJZKVBMZHOPFBARHAABXVVISB MTXUMIEAJNSGHPXQRAHUITWRXRVBNLBFXAJUNTDM GVMGQQBRHCMIBGTUEHVRCORUHKCXXFYYQVOHQNXY NCUAVMWVGULZFAKZPKXHLAABMRXVGQZBXHQDDXBY LBGQHBMMRPPXWVDPQBJFFNJIBHLBUNANRBMZZYBE OXFNJOZOAUWLBKHDZICUCKXYALULVRHJNUNCBZAW SMFTGERBLTKENMLBALLRHETOYWKIOOJWARNTXNTJ RDWFQMXGOKEVVRGQCJXZTTGFOBMGBHAHBLHKODYV VUFIXGRSIUTCPEWKFONJOXEAXOUXQBFZQPAVAPWO RGBYJAIOEUWQSRIEKTBFWCBIGXLJNTGMIIKQDZHC ERWPBBAGXGDSEEEHPUJLUTFYVQFEVAMLEQZOZBGG SEVTTUGJLKXXIFTFDQHLCNVLFAQZXWVTKGSRHBZN CPPJDOVFZEIFBPZSIFATSWDREPNUWSRRURXRKGNH VMBNGJONAXJZKBDUVEEOTUNENEWGPFPFYWKEYLOW UNOXFHZTCHDOWNYIQGGNHJEBJXTBZFCUXUYKLGJD ULUGTRXKFJEUBPQCERAZNZMZHHUOBJGMMBDZATUY EDAKWGPBOGCQBMVMECOJDVNCLGDWMSPBPMQGHXGH PNQICQCKLDUEYNXWVYJQAXZZNLBTWMGRVNFOMNBP JLDXOFGEDYQXEJQIGCLXCSCGAHACRKGECBXHSUNX MAGIIZNOWHXPURNSJLALPLYKTQQWCMZWDNAYYWVW PDHCFOJUODZUEQABPDUXWRKSPPKGCXMKNADVHMRD TMIEJKJFPQZWNIWSDJDSYRBVSTXIYZEWQBTINWLD TZYKDFHKQBSIHXVXQLPUFSBVMAVRSQHLXDUUDNZK QKCZSXDNAHQOQCSUSNUTWEZSFXBLOFVFADQFQCMN TCZNNHFEORGICMUZGWAMVPOPKUSDYYKDQOBUFUVK UAQAPBGZJDZVJTALKSYZSUCFDPIQZTONSEKJLZMP HPGBASIQVRTYNFUDUBSSRGGITPOSROABKFGGNCEN XMIIHULWDNOOYZBPDBSJEXOTQRNVTFXYPYOLQYIM SCDHQMQMXDCBSGHGWFZICBRRVDQUQELPTNSBXYCK CXJTJBPIMRILUVNYSXNJUBLJXCTCDQMGKHKRWMMD COAJOBWFWOGZMDFEZVBZHQQCQWZPYBRWOIDAHQBS ONTRAOGIDHNVANLYQODQHKEWOPSMBLWHKUMNKLAW SUFEBYBECCWIRXLZYRNF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RCPCGTWHASXZNPTHOGDKAVBHTBGBJODLVGAZYAMT VGMERXAVUVNDWJTHYMFIBGFWZUFNLTNOTVZYCTSL HHZCHYDZXOBWGFBZQMHUPASINIYIZPERBZMZVQFC WBAGCCGNFLPVKSOREAEMLOTBXODDHQSQMZVAPHNP ZWQDMCWZTOACIXFNSVWRSXFXWKDGCONKLAPOQYQH QTGCYTEGHWTVRKDNXZEMVLWBMRPLKPLETHUOULJT XQEFFPRMDAXXMCBFRQLRSIWTINFADMWEPRYTWJVI MQMEYSEITLLVHCTFCQBWHKGVDKYXRSKQMRAKVMLL HZSAMWYEUXHVDTICZCDOFFJAVLILNQNJRGGCGCYP BNRVRMIQDWTZXUOAEJZWBLIBGFREKDJPJCZKRNXG RROTARHCIVUMFUZRDFXRSYPZIGQSSKFYZHDQXOYN VBBNXGMNXINKSWEDIALOMODDXLFHTQRRSTEKHAFQ FLSUKAEFVEWVXTVZJVQIBYUXARVAMHIYMOTEHXGC ZCBLRAYOLRDKQLFZQXGLTSKUMJVZBYJRPJSFWPBH LYWBNNJPSEUBCPDQGVLMWJLCTYUGAROWIGSXIJJL GMHHIIYIEDPLJRGUDAEEKMISULCMLUXGUIVZAIUV CZHBQFYFGFCXJQYXIALTFOJCMHKXYCDRQWSUVXIY NKXNIAQDPVFWCTTTMLHKXEPDIGOVNTRNMDBVCVQX KNDIJACRIFOOQVXXRKZQEIEVJIGAACCSYFFSDSJE VNVIJZQXXGYSKXMWCHTTJPXBYFURMAKYDDHLMRJK DSDBGBRTEQFPVHNYBHYADWBVZUZFVUSPWREBJGRL QKYRAPIPZRZBVAONEVVZNWZSEPWHXUYUYQCQKEUZ TRZCDNKDGFHFAYSEGWXBLSECPKLKUYBFUSUELBMF HKILUUCOYIAXJZIVGGISNUKHOCUQBJKPYTRPAXHF TXSYZZAFTYQYUHYBMNRQKIAVZYMQEORDICTKHHVG TAUTOWOTZEXMBVHOXGPBEMCSGLMKXPVYQGBPZOUU YMYBXWSURSJTIFCAEWWQHSHLUFTMAEPHFUHWSKVI CVZFBHMYKPJJKETCCBOVFUWEBGNPMOFUAWOEWXRA XDORBGVJAEDEVLDMJDOWAOMDOGHDAGSGXTESDZIM MTCIACONTRVYZTWSLBTWOQCTYAZJGGRGZARUACJY CHFHHSXLXMKDEXKNHLWEETCWKKJDLXTZICENYDAN OGVNXKADHXWPNCTLKNQNJXKTGMRQLOMEEBFOSQXN QNKMXNPCUZNOSYFSTJLPXRXEKOWDGYUPSRGSEXNQ DANSQJSRJSIFPFKNNCQSBEAJHXQBJRLYSPOPIWLR CRMWQVEEJGDOOZJRZXFYZAIYLCGETQUQTSNFOFCC RXMYBCVXKUNMAFYELPPRZUOEDPJQPDRQTGDJKZQE TUVGBTMFNLDRLTNHMASCKZUTEFQQSZXWQMQDJXDD OCWVSJARPANIVQMKZPSRFBXKXZSXENDBFUFWJGIJ HNVTNWRCSSWEKZGOCIWWIKBMZDUNRAJSFZRJFALT DNOTZZCZGOKEVYYXREEOEYENTIHALKOKVJGEORSY FNMCXSXBYQVJAINQBGZYZFDZLHUDMPISZWDWRBUR TNOOYGYUXFDJOSZEESUBMBQFZTLETZOPWTNAJSJI UUOZSWKEECTXODIVPCGDUBBXZXUPILVHVCRVECBI WGDCMEKWYSOUKCFBMUVEOZRMFMNTJEJFKTMWUNKU QPHTVCHBCPMPPJXMUKLASBXBTGPJNLIVQXRKEQOL NPSVFRWQLXMLDPSMBYYFSFOUZUFYXIUSFSXLTBMY FXJPDTRPNDQCQAYZMFLWOCIVOAERMCNLLQIZOQOV AUOJBIXHRSWDFHEZVHUY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PXEFFSGBHPNPRNTECDNCYIRZLWUFQVAHAWWENOVZ MQKYGEXJRXBESIRUYLXBYVUGXUWMJMFPRJLHHTZP SAPCIPVXBDMNTBLHVPHRYZIZPZHBGMXRMGNDCLOD IPZMTDZMIJRYYPVRUDUTLKBPYZHTLXJRIAAKNOBC TRZASQTOTOIOKETESKNBNSGXYSALZQCPZMTZZUWX YKGQPAFRKKFYPWAQRDAARYLWNITHJAJHQLQQRFBC BCFZLKEQOHPPABJDZJZHUYEXWQCXOZTZJJHJBWSP NUGWXQFCVTCLQGTDVJHPUJSXRVEEJRZNTSVLEWUA NQPUNACMNKEMIJZRJUNSZKOVABMHCFCUGAXIBHLA SHMEKCUYKXYSBTKICXFPBQIXCZZZWSZPRVEQTQOQ LVOCZCDPDBQWDKBXNSBBKXLCCIZXSINHWEKEHNHY APCLIPOMMZRQGNWUKZMQQTVSYUIIVJWRISPHPNPJ POKRILPOLOVWXGUHGNWTIHLSWVJPFFFIFLOJCZND LXTTQZBFHILFSZSKDHBSQQGTDQTYQPAFUSFNAKGI LLWDRRZWPFWVOLJWMNGXKQCDJJLVGIHQIBEQJATH BXPVTIVTWAAWNSNRJIIHLNJRIGJGARUZAUAOEYMQ UJKINRIUVVSWXPOTZKQRQEFLQEQTZVLIVJOWMARF AHBLJSYKNDCLXAVXUAUMBHLSXZXGFYZTFCYKLBQU WHHURHCWBZQXQTATMOSBODSNQPFZEOAWHMEROUHX WEDZNURMTZFZWKOIDBYQJUZHDFSPAKAWPFHHFURN XUJDOJKLFERYOUAJTZYJUYCEKTSYRTIBZTMPFZCC QSEEOMVJLNCXELFSJIAAUNYVYZGLHNBUHICLVNQX QJKMSQIHLNMSRTLHAHHCCTQBIVSYVPNDXFKALMHA MYDLBSYGZICTDIMSIJULWHYJDHLXRZDETLVVNSDJ VCBERUZWRLDPULJTBHOPDUHLGYXNYYBYSRYSXQPY MRWQWJEZLHEPOBILOVOFTZKGZPAYMYCPJCAENPML SVVOLJDNNSQUZFDWMQUVYQOEOOICSCXVWSBBUFZH HLQNCWYPESBBOXXRSJGLOOBDSWESPVJOZNFOCOWO TPEKUJEVNAXVKKIYNWAHJLZJQQOJETREUIQCQJGY NHGDKAMPWQQAEADJSAOEWLOKOCBAVUORKTGVPJRU GVJHMHSQVPUSFKAFOQNEBVKWPCYTUUGEXYUMYOQS PZNVNPPRAWUVVSSPEJOSLMPPNKYGVJXCDHAMFDHT UCSTFYEDGXDFTKOTGMARGDKYBTURHILDYMOENBSK BXYHGZYRRGOGRWFACMYGFYUXNYHIHLRXLPGYRJEE UYHYSVCLHTTEPJUEZJUEGWSJWJQJIUGIZJDLKWEZ UGKWSUEABTJBJZCOLMRTIWJKELFNFLQNUNBHEPAR SAJUXOSUKVEBHDKIRLBCQSPFCHDKMSFSZUZUKBJP VBXJGFFIISKKJGVDJSWUNWYCUMJXLFJACSRSRWIK YBOGXFVTAEEEOGCTZOQYYYNKGOOWETUFLMESGKAS FOAQDLGLSFKXSZPWKZOLQRCFVSGAHETPPPFTAGQL MFZYJVNBMDEFYQGZMAJAGGWIGKQICPGCQFXAHNCX DXQNCLZEZXILBRKGZMTOZXWHRXFDHJGYXLMTWHBB HCRLQFHYGIGTNYSTDKTPGPOQIKHJPNHJIYJZLGCC PAPPSQEEYNVMANZYKLRZUKCABTIOQKGIDXFWEFXO OEJHIYKQSNFPHJDCXJRGSSZGAVEDOOKHMLHBOMBT LTMBYTOSKVILJDYTFCERKDNWQNKVSKSCTZBWKTUX RWXFSKASEHNCHEUESMTEYLYWXMFNYFHJRCPBAPGK YIJQPTSEEGQTGUWJTFAB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      BCGYMNISELTIJOYFCMTMJPJWGKLVEXGBJTVPLDAQ ALYLEBYAWGQSKBMKCHRBIBPPGBTDRUUVSESQFSFN VWQBWQTITGPCIXVBKVOARIESGDDZGQPMKTQHRMPD PIEUQKBAYITTFXARFCFLDUSKEWSHYBKZNSCRQLAF VVGCYIGPYSHBWOSHSXGRIFFPNVEAWUHYPHOYTWEL HLJKXCAIJTZQJOICROSIOCYIYVBWNYEFAFDLEFAM IQAYDDKYPTAPABLXTXCSLTBKULVCKBKTTIJPUPEV DYCLSNJNTCPSLFPOIPGYSOMWPWSSMPPGGKILVDXH OLWIWLPQFSVMADGXDIMBJQLGYIDHJBBPKAJWEHYH IKYHSTWBPKJCWKBRFVCKPSNLSRZBPCJXAITJLIGM FRURRGFBCBTWQJUZCWIUAZMGEFRGFJKVUEIMYWVE UNTTCSDGIQFPQBPVATSLKUCWLIUAJXJEMZFOXQXV VINUAEFYQMOLCSTIMUKUKIZAJYIKITNJSBHNCAQW ELBKGYHBKOTTYOZTDCSVLIZEEDKNJGSVZOICKGWM BSLVYSMOKIWMPGDHIUOFFIZRLBCAGRPSKRXNZVSG MXBKTCDKAZZFOQZKSIEDTRIAAVQZRZYWVFAMBIEZ EXCOTEZEQQMLCIWHXFRUAIMSIJEFTLSRNEEUTADH UZTKYVVOIIEJVOLFKDMHJJYEGICHYASFZXGUEEEI TBERQZDRNAPQELLWLWVEBERBNWQIQUBINVKKIZPF JHCZLFYXAKXOQLLRELTNCIZWQINMMHYGDTXITZHV VVYFXTONAOFOVBOXRRRNRYVZPESPGMLEEYNDQZQN QZLKEJUNGUQHBPMNKSJFDMLDTAAMHWZJDXFJZGQL SQHMBDDKHZOIUITFKQBTJMPKDNANKYBRKFCVGTDC FMWQWSFWVTJUFYJBEMPGQPCOCPRZXFAMNFGGYHJW OCHNRLPYZEEOPKAMFARIDMCCBFSTUJYHVMORRXGE DHXWZFHKODUXJMYUJANYCHLGWDVCABDIBRSDZZWU NYYVDMAEHNXNJJSZVPPWIETKKVNAZGFPWBZUYSQH PRTJQXVUMPEZTIPDXIHLFHNEOBORQDAOLRSVHIII YLVPMKDGJEYWGVLSZMTDHHGERZWTWKDFTVWUJNMC XCHNVEUGQVBYSBOVWUNWHYPNTTKKRTFUGTPYWSBX KARBVZMCXQHUZBQAFCQTLWGFFCRZDEAYKNCSEKYY VMKZTXCJRVOSZHJYNKDKBAMDJGDGYFUSEYCHYRFN WGUVHUIHEPJQQAXULEDYHBIKBXMQCNNVRHRRLREN QYXVKBSAWLGFAMIDMUQJYIDJIAZIWGRQIXITCYKK BCTERIXDVJTZSLJWAQMRUKBEJKZHKCEFZSUKJABS INYTQFLQKWFUZPCSLTDCJWITJGULVDDZCBXDHFLN QLXXJDALUXPBRJQKUUPSCTNCQIMUEGYYXCSNHLZU EQYGEMCCSZZIQBFQFFHGMTKCFSIQEOLGAFIZEZUZ CYEWVCBKFCSJTZYZTWFPCIDVFLYNLRVQOFPISJRF NXLJBLFEMAOIDCRZXQHFXRBCJBHGDPAPRFRUYLXN HGPCGCMWSXWMREMPMKMDLNDNZSRYBLTGCQQBEQQQ CODTLETBWMTVCZGUZFIEDXWTCRLVGBAEQVCROFWS DJRDEKIAVWXFZXWLBWSROQEPBPQACFIHXBCVHTFT YKJRQVCVQVYRKWWBPLTLPGISVPOQCTSCPFNTURDW PPLADQYTBOYDQKDQDUERFLEVOYNFMMNFKPSNYQNF ODASGRVAMTRBDZRIFFDNXUQPPMLYEOWIVBXXMFTF FZKLXMTFEBBEASITNNADWBDBLJWVZEOOTOJVJYZP PYEPRZJHNCKSBCPOYNJQ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ZWSXVFVQVOKJDRKMSRVIVUERYWYWVKELRNIXWOPE GBUNROPNHKLOXOOBMTYJGTXGOEKPAPOWGHNPFTSC GQMAGGVDTGNCSWNGVMWDCRUZVDPZVPVCMGANGYEW ZLVKAXLGRCGLPFKIHGVNCEJVYKJLRFRORTYLJAJP BRXPJETBFWMXIANUBWNAEXIWBCGURGZCXNZCRVSQ MKUMZACZFNHJGGGLCQLTKPWGWMESPLANGBYYYEZE JQJXUQZJCHCJLBXKODDQBWPPRLOUUHYESMARXHQL NCXVMVKAZOGNJUZIPQGJOCXNPLBTEIDTNZNCLOGD WXQLERNOMQFCCVKVGPQSUHCEKDPFMMHZWGUKIIJH PFAWHYUBKABINLYPGFNXSJDOMAJOBYIPULZSUVIR OXMODIHHKIUPCGAHBAQFNWPJUGWCUBCBTFOKMSFX LXBPJYOIJVUWJWMZOBSIUVQEBLAYJAKIFFCKAFAW APGREECJNYETYAMCEGCQRKOPINOYPEOJNZKTFTYA QDWZAKZMUFJGBWBAVHGHUHRYQZRQFWJCRUNPEKTO FWMTMNLFHTDZOXTBBEUOIJDPNHNQUPSWYCSXOSEY GOUAYGRNIAWBYXOFVGDKUMJHJDBEXBPSFUODVEVI JPDTGDWQXOOWXUPKPTOSYPMIDQZBIALOVNSQIRFN EODVMHMPPIRMXNNJDXCIVKYWLHMUAMISNLMYIGPJ PVRQHKGREJHVGRFBLDQJIEQUGEIBATGIHTYMCPOJ ULLMYKKOVPJWEKPFZYNGQQWXMSDGACETIZLRUAHB SYFSMZJFGJBYXILRTUOXWWHQDBZGCRROGJQDSMTI SYTBVFRSMFSLFECOATFWFPPYGIUXYXFNBZICXKDP JZFEXIBPXUQUBMHFEIXMBDOOLOCHPPQSPZOZPDPQ HGSLPLVFRJFFDUCPDJPPTEPRZKFKWVOVCBTWNWBG OLBGQNHUGJMPCGNKWNMKIZTTCJQNVSUBAZBCFMSO FACQPQMIWNTIROQIPMHQBLRRHSGJHZXRKAXPKTYM ZHVAWLWRNXMGWABYJPBDWDGJYGAOYUYRXWSCDLYK WWDUXPEFEADXAAXRWTQUSRNROSJDMMPUXWRQVRSU PPXJZGSVMBKJYEQHSTCKOJFCMFTJGGIZLZVTDBFS MVFXCZWUVMQCOLYJKCMAMZLZOPPXGENSGLPHLTLP UMBXOLLHFDEZANNPHNFOKWSOFIEOJMEVWNFIGUQR VAXMCWQYMYDZENTBPZWMOKNHCQLJJAENYLZCXTGD NRYUQBOABJABAKKKSGXKIBBVHFFQXLJEFQGREDIP TFSVNAOLKSWBABZIOIALKTUJYIOOEDCFMSATSMIO UMKHNVNBPJHWFNYSSRKCTOQMTZNMTFYUAEJVMHCS OJKZEVNWWETQYTSBQPHMXUOMSTVVWKHAKTSSUNHX OHWKLHUBJGCPGMXRJAHHMURXEFGYIKEKFXPNLPPP JOQKDYQJMEYLRZWIOLGZQBPHTFZCBJVSMXFRMKFG IMFAQOOKMGZBIIBUIVIOCITJOJDOEWURKSGUVMYH JBRHDPJWLFDRKSFPMIFVSSHAPBJEFXRFSMDNIHKR VDAVWPZSMYHUHPZPSHRGWXKOOUUGIVNNRBUMANBI VNJDNZWCDQKFCELUAJWDLJZJGVKSUZKYYKUFINPN DTJFIVGLJYWZHFJJPQLVMZGYVHXRLQHZNZWXMGQC YFKLTPVJLAKQFEQSYYDILYZWJBXREXKKLZQTXIQO GHOIYUQPWHYGOLZSMEIUPDRVGXDEAOCDYKQFRUWM TQJWXBZDJLDOSMRNAKJBRGHSFIAODNGPTFDURVTC ALJEHMQNGLDYAWZMYAMERNPONEEJRQSFETNNMPAM IRIDNIMWIMGOVJPWVSST
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DOGWIWVHRAUOHVJPJOOLJOKXGVGRTGCCFLMYYCGT USEGUQWSRGUJQEZLVYVZQHLXBPGYCCHURMEDPTCX DMUHEDHQUXBEBVYPEBXVANDVVGSDJEIIGBVOGUFA CBDOUABIJYMJUCPHTZVGOIDTZOVOSRHVXEZHRDOA JQEXFHNDCQKTZQNYYNMASTVARNJRTJDQLAKUSWGZ TOXBCHIVOKHLIIXAQNQUPOPKDGDEMREJBLVVWWTP GCSUTWMHZFHNACAPKFPJGKVVMELUXQPPOTUKZBUH KEYVPKVXVEUKXKCNHEXEBVDXMXIOPNMVHUGOAWSY EKBYRMKLDMUZLOWOCIIREGSKQSMOYIZXUUKSERSC ITEMJAGEHPJIOAAVOMXUXNVEOUFSRQOHNNMEKWBD LVBTYQZADHRUTSNJYFPCDNMXEIUYBJLFGXSVHXNB XPUBNOULYYEECPJTKFKBJPUALOXAYEJMISBYWJIE UYUOSXVNINWDWEMOYYNWRNTBMCIRGZWTEUXBZLBZ POPLMPQWDOBDUIGJCDNUPVSKMSEYFHLBTRQFOLSS UVKMBHOZOMISZGSBBSIBNGFSWBWYOIDTQUOVTULW QMHEXEWEXWDKAMHMFWXZLUZCONRBSOVETTDLUYQS VAENOOGLQIBDEPYCUXAAXFGFJIDLQZJIDEOWQQMA SBWOLAFJCWVBXUWMAWZJGGNKKTPXRKHRMEQXKNIF LIVHISJQOTREOHPYCQKKMGLYTPCJSJLAJEYQAKRA KIDSCCHIVUUUTOIMXYQEMCROPTTTBESPZQKQQMZH IPHCHCWDRSXFLQFKTLETODLYBHSUOIYHPZOFOXKK UDLEDFQHUSTDTNAUYEPOASFHCOSSAVOGKKGFSKZB YGJSFMDRSWKECVKNLOKIZWVUPMOVFDKWPQZEJUTL OUQYQIGELKTQRQDQXUQDYWHFVGAGATKBSCCJYOXD JUBZHDMSMMJHEEUVCZCKMXHVJNYKXCFDAXGTYIDI ONUMWNIPNWNYKWKOFBXBOYKHGCQTCBIDHAJQHQML NFFAQMTBOBXVTHAJQHNUVCWSSTIPGSPGTWPQCUGV AMKVTSYIYNLFZMWNMDNUZLYESREPZQVDGHGQKSPR YXARZAIHHCVNGIVBRKRANCBKISNDMRZRESLKVWKL SDTCLAFXUEMNWFAEXRURYHKUIRXYGZBOTJPTLCZW GSVDHCAHEEPOVFUFBLGOMMARDXFIGTAOTWXDAWDM YQSKYKXVJPBWMCCIPTOWWAPJUWBQHVAFYPRUZJYW APBARPTYSKVVTZWWKXHSXJOLNIWVUHHOBLYLPVGH SIQNYRVNEKNIIJRGCBCROXCTWYEHNNJGPFQFWCNK XHDFSWERDBNZHXVNVMMPUESOGTNQVTUAYUVJDQLF WTCUQNOMJCSALGCOAEIIGRQFDZARWOYYATBSSCLH FJOFYLFRAGLAOVBTBLZUWNFOUNPYUEEYPKHRVUBN SFSHQINVARRAJPJDSKDPAGBUVEJLUSHJTJCVMTYT NOMLLJVEQYEBCJWXMJFFVUPEVGBYXFCVNOLVTZYP YCNRYUUQXINTTWBUVVFFSKBSJNOFHJEWQXYZJGUD KPYCJAQTDWCZDAHZHFQPIGAAMOTLXNOVRRXQWRYZ IJQJKQBVJIIDSVAVPADVIUPEYPGRPKHENKVRDVTW VDCCFYQGDQNUINEWWKZPMBOEBHEMKPOVNFISEADV DYNCIZGKTKOETSKGNQERCGNQMANRSQIDUDBACSQG NDPYNFLRSSYRBEOHHKDVXATBIGELNTGROSYXFQVB DEONJCWQLZDXFWVJJHYSOQFUICHKJCOGTYPBBBLR UOMRHBKDKXGLRKPCLLEWNAQSZEMZLXEHBKIVQDJY GZASTCRFLBMWEQXWLLYY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EMYXDHBKSZFBSFELEJIYYPHTOWZHXEZNKQEQQAAU YMYZCNDHCDNNWXPUCOXIRMMTUHJSVJSQCHZZCGZK YGQBDVJZLUYMUVGPSCEWYVQJYGKTPZHXDGFGKSGJ WASHJUCWBBOBOXXKYRCNGCJDOWZCCTWSKWUZWSCI PYJLLCIBNCHIYWJAIVPBSVYNYHUHJBMTHXBZTMDM FJVWQGLIIPLHVXKROGDRBCJFZDBVXUPQRUCDDKGR TRYLNPFPRUKZMPVZUVIKCLXIPRMDVFMGBTACGWFQ BSTPOAFJVURTAUNNMGZJRVXSHKJRXQJILWOXUHLT YGQFSRUJAVGMESIXXFPHHNBRTUXZWOYWNGLETQIU BKNNPBDNSYSWNTKZPFGOPCENJLSFPHVSVEAFVOZR MXIEMIDVGUECNFSGWRVJTJBDVHAQWEGAMBWLNXAK KMRBJEIWYNBLBFUQXCZZPDIEGATCFMRRIIFEUJFC JMUPUPIMSUJHEPJJTXCNVVRMFULDOAATTHYTJLDV BPGUOPNHWZPIFYOFGYPAICZYOGAZUYUICJCNSWSP XMCPATVTCNLUYJYVOSABZEAWSNJCXIOYKMWTWUXK RKDSMQMMFWTTXQWNFNMQMOODAWBOITLMTSCFBEYK AAJFRZVYXBEPRCHNWAJLDIAZSQJENAFTTXZXEBRR LTZOZBXDQTIBNYLQFDLPUKCRPBEJTQNKZMLYJGPU LAFFFIPZJVEKIKKNVBACLZIOJZGLUWMCMEDMANQT IYCYPAYFGRNOISUSXBERLOUGSGAKUSJMNAQWTKAN TBVZRZLREBYTVFYNSZMGDVSHGSLTEXJPVKCJSMWH TWIHDJDUKUKORTUZUKTHACVQCPRZPBMXYBEIMRXW PLOJXVNYXFOEARCOVSKAYDGAJBOOHYNMYCCUVZED OYVIQFDRMHBGWLLLQAAMIINLEQPTKQZUYEJIJSGY JRFYCKKOXXODNQVRHHVPDDUPAVJQSNSSJSVSETHB LQXOBRNZFRREOFYANSNLXPRVTLPBSITDICZTAIAN PQZXMZZMRPYEWAZXZDKXKJYIOHNEFRKMCPEOLLYL KIDYMUPHTFJWUIPIAPWKIDNZBFGFTPKSECCYDLRB ZBASTUJYHJFCQWTQWURFAZNBTGEDZVDTPGCSXTZO CEWUTIBGKZEANZILZFPEVPYMFDHSEKWWEKJCQICQ FQPUPYSXVPXIVBQDXGQPUNAOTBLVJNACLRLRDFQY XPRNNQXHXFTFRSXAQUDCVIKQHJSDQKEPUNTRCWKV DESHVATBBZICCUPFXRLINADARCRXWAEZCFUOEAIX VLNAHCBBSFFPWWEZCRVDNJOVKKDOOCCEJOVYIRGT WZKUHUINBJPUBAROYJBYYJHSUZCXAZNAQFQPUEOV DQQOTMEZMPQIBFEYJLIVOBKLKCAGWPMWPLFXWEYD TLTPDYQVSCTVPQPQTHGTLPFVYJMZLLTZMEGUBOUX AOYIMIQNPKYPXDXRZDFDINSAPWJLNWJGWQZKIGAR VOPHRIUUKRSVUJJXKUCHITBLRBQTFYRDHWWBOFKV XXJAYPHUOTRDLEVGWBCWPEDJMESVGDEXATRELHZW NDZBNHBMYZFVDPYBPNRRITCHBMESYKZUNHIDFRUH DOWWQLYZWEDXKGENTWKVWSLKHLFAAFQXRDXKZOZL HMOWHWHJXNERGSVKVCNNTKTFEPMNGLIBXRMAAIBV DXOPDDRPPTBPPAXAGOFCNQYTBMPIFIKDBXQMGIGZ PWESHWEGGSSFPIWHNWNMLADUWUAJCVHRNSNCEDWB NJMYWCWMYMJHUQSZHVKIZSQNVZSIHVEXYFIURMFA MFJTRYFLKBBIDEEFQHHJWYDIBROMSJJFAXFQZISK LPCRWSTTXYMAYNQDRXQJ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FHSIOVAYUNYSWBMEWHUOPDVANNJLIJYSDSRDNEXA QSPTWSMHOEYXAORNXWQCTMUCCDUGYQVCNTFJFLAN WTURAJZUAWDWOIEKWYUUUBDBNFJHTFSBVNHSSXJM XVVDENXACBOIJZPLTZJJXTRXEHVDYKAIQCHXZWKK JKCYOGTDIGQKZFEFZMVHYZKHUVZMWREXHTSFDVHY TKBBUYAIXKXALZAZJMVLBWZOOSMGELFAOOCCYPTN QXUDPURCFTSSXMXVXONEBZWEBPMUXNZEXSELAHFR OVETSRUHKXVQHPUEIZIZXTPSQJKWTWYVZTMSEKTF KXYXMSAAASXQAPKUISIMDURTKOBAVEHFYQHVVUMA ZKKGIIGIYNYKLHOXWGQMHJXEQVGUXNICSFZQWOCQ TBLYQHRYXRBAIKDNMGYICBEXZCOKSEKOEKFKJOFJ WUOAPXOXBFZBLIJFHHVJOSEQFDRTFLRBZANVOGTM MDHUHUYDAGXHZVJDKFOVGCOEXLZRQPXQGZBMSZJR ESPSPQCOOCACXRJGQCVOVNUCQBLEJGZBYESBPHJC UNUHEZKECRHLCRIHJJQUKFRQBMJLHDHIDWFAOEMS UJKYNCGAZIGAVRFCVRNPVUAXZNBCZDJPZGFCZCDB PPELPQNXPJYYRSCINFFIHGPIXERCLQDSDYLIYKRG KAQEUGMTADMDNGQOGZFAJBMNZTQNCXEWGSDIJDCI PHDIFVRIPDGOXKWTGNUWNYBTXGBTBDOCSLELINZF ZPRQHPKRUBGAWUKKXBGXDNKSUUZOCCBQAJUANDFN EJBJHRZFWNPYFYWKGNVRWNULNLXLKUHMAGWNJCOR OMFRDTFOOJDLQHJSMKTBYOZDBKSXQOSCIUPQKPCH WTWFRBTIFWCWAAWGEDRSNXOQLDLWXBHHOCYRDIYZ WSYVRHOKUIGIIOFUNVZEQGSHSRCOAMDOZCSBFBQG QMOFEFNKPJQBRNILLVDKJYMDGDPNTNZNGDBZDEKS LNGFFFRDWFORLIZJAKGELRLYSBIKLMBJIUMVDYXS IDHPNUHLYMJWTOQDIOANLNOMGQCSPFQQERLRJRHF XSSIIBTGRKPQYEMNKNUDOQLDVYZPHSCIUJNWQCXN NBDNWMHVPFPYSUFNEGOYBBUCVPGJUGWQIXEHDZTY FIBBEMDRWCXWKGZGINPLLMIEKFVRVJADQUVGUDUH RSEMQSENZTUBVJIOAECYLAZFEFEPYJUAOTSQHLGS APWASLHCNFUVFACOGGVQSKHENJLAJKSLMSBMNBHI IJOKFKHCGDUEYYQWMZEUSWJDZUJMDKAJAMMMBMQY ISOAMZFRALASWCFAKLVUYRXWUXRUFEXMGHNQWFCV DCILHHQQZAPPUBIXPNMMGCBOYDXFMIFROMNNZMOH FCLEBCNQZJOGFBFPAXKHGTTTZEBUILWFBPKFAUWG BCWBGNDOGUAFPJFILODDNRDFEYPETPBRFNLERAVN RXSANYLSYHMEXQDWLIQUFHGIXFTMOGVNWWPVXDRB ILBYUMYRSYPXOPMQTWFPGUVRGOTSBZHUDWAMREYC NRZBMAKNETTYGYEUNLBESFCWLNZXSWVCZEMISPCQ VCZDNPSSHVLODGENWHPBMPUKGJJVAISPVGXPLJYU ACQVVSGJGRXCSKMEDDMJMFPFNZMDSYIAPBXHHKHZ TJLQOFYOVKHIIKXHMPKTRQGDTBRUGRPHMRDVGEZB DDKFQKMNWBXYDLFQUOBPRALMBKGQQSKTSDXXXTWD DAHUIAOPHYNBOQKMYORHAMIIIRZWRNNLJZHQJRPQ IYNWCEXYDNTIQKPPWQWZGXRAYOPUHJQNYGFOIGEG TNYCKEZQCGJXXDHCLZSACKKPWKNVFWXJECQECLJN KFXYLTHHNYZKQDHMJTJW
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EPGVNOXLNROPXDCDQEPFAPMABDLUGKLRLVVJXFAO KVSGQXOHPGLUDJOPKUWBZUATDQPMVCBVEZCKZIKX YPPROGGZBRJLDPDSQJMDHOVACHIIGYTKCANLCCLJ XAJGYUPNFADQWNJBBGNFEIGALWYEXINOIBDYBUER CYVZUFGBEAARQXPYYXKOMHSLYFEYJRBVKFHJJCTN DHBVUNVUULXUMRMAKZBJTBELWFYOVQQBIXRVUBLS ETALCVAUVTUGXVDHBCPUZEAWTKZZHGHIZIAPTBUB WXEJCUXRVDPPXFRGITFHSRUFMOUZYZTFSWGKGOAD XFZWGFQANQSCVEGRZRFMVTJBKAETSGGUVYQYDISN NTMOWFYWOXLSRSRSYRNUDQYKRIXGATUHQDQDRHXB TLJPVBILPKZFGKQZLGLSWYJXVJUDHEYWREQTXCXN ACMXDBTMGNUAUSEVRHAVCMZIVWYBDEWWOLJWZZMV HGUNQIPWAYNHUKGQEMDQZLHHNSIZZNDUVVWECMBV PFRSLMPFOARCPKJAHTZERRGEMBGFDDEATLHGCXPD EINEFANTLEVEGOXJDGPRIUIUUVBEZTNWNYSKUQXE GDJEXESGORLZOXGRZZDCMROKCJILTQEFFZHAEEXL VBCWAUJPHWYOYORBTSMUCGPVDZWAEXRYGFQGEAKB MRDOIQMGSYDUMMRKJSMIOTHTLOGZVLHCXWZGEHKQ TVYMIIKLXXCFUMXWQPOLHYHGFSKAIPXZZVOVBXPJ ZIEJWKTHDLJFGYXZJBXVKATKIUOSHMLIMESKPXKP QDEBLUGBLBPKWTZUTWMLNAKEBQRALSWZQHESPDEM FPOOUFKACGJTDOVQKRQCXHOZNDXFLQMCSPSSMXQS TWWFNBQFPVNZWYIUEQERWZDDOMEEBRUDWONEFUGU NABMBGKYXORVPKIANYEMKLOCHXMDNSSSEIYDRWXY QWEHYXNEFWVSEXJJQHPSTSODHTFDUHFOHCXLZJNT KOHAGNTNHACXPEHIECXGWELHDGMREWSVGLUTVENA JFBJKUMHBVLLVPCBXRQAHRGUXSRBPPZELTCDJJUP ZXLEWWOLIHEANLHWLDSXWRPIGFXKIPJIZVZHIALC METBTWRGXOIFFEFDHEZVJVHROARWKTPOEPXIATXW CENERULLIYPUYIAZABMIBTLWQSORLFWZPFAGUZKX RDTMHWZKKXCRCNLQESUWHSGOCULOYDKDNTLOJBOX JTQIZGRRKDGHCAOEVBRLDREZJEBFMGSKANUDGGPH PSLCIYOFOARHACWBKCXVEQCPJILNTQYMTXNXRNLW YVYVBQUUFLMSZOUBYJNOAQEQBXQLVVODOZZAZSDC WYJPCIMXSBWKYCBRKRWGFQXQPNCFBYFPBKSHVZDS JHWCXTGJYRHWDAXDMFKVKMPUKTNOYVVTFOAHQGFT ZMQDRRAXAYTCLSBQIGPAVSPZRLWMHOFIWYPJXKVF XSZHQFRTKZLGATCQKIYOPCHALXUDDWVNYSMAREJS WIXCSTVOYPCLTFUCBHQXQCXJPGBFGJDTDUZUMGER DALHANBSAOEFEUISOEOGKETSQQFITBSNDJISPSRV DPVKRZGFCKKZATODYZONSHCOLCMSOJMSXPIXKEMJ URFJBIVCMCDCBOOGAHORGKYEZJEZXPMECXTLRKIA SOWEISTFXBQEGVNZNAKJOFLCTUGZNUDIKCMTVUXE GVOMLYLJCTOBJCIXUNVNQNUPPQJCWYKAEYCTIVQK XAKOQIJRUVRRAMBAXCZMXDVFPPYZQMREFCESWXBC SOJXJOVJPXNQVZVPDNKXOKASWEHYGTEHLSOUHFGU GYYOUWVKAWYKUUEEHVUXRFUMNJNMPCKLPXUCTHVF XKPURZSLPBSNWAUNHSED
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FPGJMMOTDQNQAPDKJUZIBNKRWXFHGAJZNGRBOXYI EKOCSPJZHIXFFMWMQFNNLEMKMGQNMCNTHYCPCXLW YWVJLUBJRPGVBWXRICKMUUHWIUXGEJBDCIEWSVQA HFUNMIKCSBPOCPWAPIQXQCDYLRIKTOKOMLYRSLHQ OYLMIOWPGFVMAGWBWCRSTFNISMCPITKSNZDIAEOQ VBCCYCHEEPFRCSJTBVJZPFCAKNZFSEUMUEJQMEEM BLQTLZTEESOENACTZSYLFQOQVLGKXURAQXWLEUNS XWUGVNWKRBAJOBNHWCEETGAOHRWFUHOEZHMWZOZU SSGTISPPPCEPKNRJGCQBWQLWKVSVMDVEHOUUOAKX XVJYXLFZFTGFRXMYMXWUBRGTPCBPYGQHTRSQGHJS MWLUJQFWNYJISOVRCXXBMKZBXGHDMRCKVYUAJYVA WQERCCOKFEOEEGGSGXBSSTXJROFNJUZMNRACFBUY XIWMZRJDNDCVYIMDXDOGWTEIGTERXNKENZYVVAMS YFTLYZCPSVTVESDHXUMJEPFGZDJNZCERGPSVONFV HRTKBOUDCCSJYOFDWKBUXHXGIAXVLMIPKYJMYBHE DUTJMEDJKJIFDWMFRRAUSZJKLXZYJUBJJNOWHQAW EHOKUZXFMQHOGZFIBMHQSQGWYJBLZNSLDIRJCOQU JQRTDQLLHIPZIWJTNACZRSGSJKSJFQKPRZHDUQVG EEECQHELXUULKDHDOVFERKWQVPJYZUDJSOIFPLFH PZHSUJIFOBDQZXLIAHAIWDZDCYXNXKIVYQQUATZZ EAYTBLSXZVSSVMUELQGAIMTWTMAYCSMRZUPTDPCN JHHMCONTJGGNWZGNBEFEWPFHLYUDUVWVNXMGZNCH DRCMFPRGSFIEOZYLUOSGDKJYSVSOYDHQJMVZSWOZ KYYVSUNJWDBYNOYAEUNJQXUORFIIDUZOVYXKONPF GKPMTNAWUXFKGUEEUARYUPQQPUMQBQJIHGEWMBMD CHSNXEMIMEMSLMYXTYOCAXERICGBMWVATMBQIMYN XEVOULRMPLBKAXRLUEKCFSSBPBPTRAZYORBDJERT BYVJBYYEYBBMKXTHUXBANEHZVGKSLISDSHMXGWAB TDKWURRUIZKEBTJBCFWCHEHAIHUUYNYQCAWHMVBV ZSAZJCQXXGXZSJHCVOZZBJVNFZEQXPOFUULHVDIS LQFANWHWIKOGKBDTKXPFIVQDPNZJINVERFBZMLFJ SJJKCTBMFMZENQWIVMRCTGUXEUIIRZVFWOHICNPV KTWQFRTRYLNTNCGDTZTQYWIKEMYEGJDYCQYIIAFP LUQMNSFGSZKBAMWPQJQGMOHNEOZBVMGNZCCXOVLR CKTLFBCZMMTSOJPUXHDBFSMMMKXYEJNMZPSKNMPH QTQSCOPPIXKZBTRGKQLNHKKZIYLMKBACISCIFZWN RKMNNQSTSZYAKXKTWPMIRGAVNHQSTRJSNMNUZWMO HRNNUAQWBIFPSEWYLCSOQQXWMDAZLLYYDFOAQEJR XJIRLIQJEUNHCSMLDZTNYJSVHBPTLQTOOZULMQQH XTBZNBXDPYPNXYSBZZSVAKDAZUMTQXKMPLJJCXJM XVBVMUARIKXSEQWKKGYNTABAOGCWXQUTUVXMQDHZ MWJCJQCMICQQAMYITUVSKCTCZBZBYCUNMAQNNXFP FFLICBVNKUYWMBVTRRWTHFYFFIBUMSLXXPAWKEFG HEKRVAMBQOOMRCNXHXWSZTPXLJWTGKUKTXDIGXRV QMSNNHLEZWKJVFZOMBIFTZKNQUKBEQIYONNCJHVT BEDPMZMPEUSHKYFSQWJGWAVXGHLFEFTRQRQMTRTI SBHKWAQBTCJHJCXGFBIXZUVZOSISFFKLMFUMOEVP HJWWOWOQMIMQIOCJBRUN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OFBXOTVAMQOCWKQPEFFMRIQKWNTXUJZBBRYPQKQM YUEOKDAUMBVNTMRWKDDTLQFRKWOBOYBFYQCCSOJF QQYMMTNPEDHGOQBLUGIRORTFREMXOFOALRLEGKKT EHNOUENVXUCYTAEEZHNZKKDFXBECXOUYEDJDFNAG KXGWRRYOIFLTLAQYARJMTDPZLJUEKMPDDRHEWHZJ TMTIZAAYQZYJKJGZQZAMBTWCGMGTLESZZUEMYECM ALRIXHIPGUUBHUZTNDYXKYBLEXGRBMHLBPBLUBJI ICYZSOIKVBSQTCFTZRMBTSEKPXYDUDYJRYRIHCLN FNNYBHDOGZITVQOEANZEKWAJAONGFGVZZGYAIVYS UYVOMFJYXRPLBUBNOWNAYIAQZOTWFIQQZVRTWTYN DSKTVONOPNISDBACGPBHWVNMBICZDPTHMDMTNPWL LUKBZBZVVDKEQPRMCVPDCFHRCPMJQLSIXPGMFTEO FUCYWYKDNSMCIQEQYWFJJTGHIHANUFRWXHNESPQV SOIHHUOWMBUTDLGINWCTEAJJHWQNAMJCLRSOFUUN HGDXKFRZZKQVFPIGZYLXZRFJXEAODULCEDDFEUCY WSBZDNZCRCBWBFNRQMGWVSFLBFLXGHCNZOSHEWAU AWFAZFLHCJAEKIQTLRHTSYOCMJEHCQHLUGGHWKSO LHIFBFWRDFKMVRDHWZLGSAPEORGSXIUWUBBTPTGO LCPYIHEYNVDEOSQXTWDSTAHXVWKLFYTODARXSCKT EAWZOLPVGOXFGIXTHYTPAUWSTYQYBLKXQADNRSEQ YXDZFGLUBNQCHHILGFLMMGYVUOZUIVIUNPEILCKW GPGJFTPEZVTPZRSQROSSRCQTUGWWSYXVFYLLRAUO TPNUEPUTWHIDDZFNOONJKSUUZLNMXAEPYSLGTJIB HASGWCCJNDGWQERHZWBHEAZNXYYUZMVAHENWIOUM LYIIDZITZXEISQNDMGWJXNGQFUBQADSERRIEKNLW WYJJQVDURNLHLKVCTMOMANUTTEGYUEYMDRPNLLUS CVROZICVHZJMEXJFQKJPKCOJPSAFTXBIKZXGLEPN FBLWCWVZCKVTCQYGJOXEGIZXRKSRDFJCOYUQXOPF UUINHLDMBDDEOQECPZCLREKSRJWRCOXXZZAYLZBE YOENQQXANXTDMXUJKLIVQYTGCXFPCAUWBWLMZYDJ VSKSDXLSJEYGXXKNUQICWFYZLOAKNOGJIZMPJGTU LFPSIFJHCOPMRABQDBMHOXWVWQRANIFXZVELSPUL OIINQGRXINKUULLMVODWPPIBPJPWXYIIGPHWKWXA NRHXUPABUOACHICZIOXMJAHUFCPTWTMIKDYECKXZ YEDJLOUACKYUDIQKSTRUBHXZGOEOZMTWJVEUQZMH BAHMNTFGGPFTMBSUAQZWAAAABEXBCIBQNFDVJJBA PIUPZUMXVZLPZMNLNGAENKZLERXFBBCLLGKENGJO OIXOVGODSLMNTZBMIRNJCKWTWCFFSBVBNAUCDUPO RDLFYJFVIJPCESYQEXSNHFYNPKKYOJVHBFHVYXYJ VJGRLLXXLFUIKKSYHXURXOHVQXJCCSHYMOXZCNBD XVEMKRNAWVQNARWPABHGJPKZHVLKSOSUCWWBJMNA WJRHHZYAMPUITUVXDYHSYVOBTQDMPMZKZKQKLFKP KQMTEMCKCBBKQUDKPHRXBTEUMVVBDUVQJIHGGNHP BGNKMIZNDNYYGPJNPFUACXLWNTMBPZGKPMXIDMUZ SCRZHMJLCLBMJORDKJOBWSDFQETYYVXKJXJNYMTJ BNOOCIUHSWIETVROIIBUTOEVPXAHYVXBRRCLYBOQ YKRRMQBQCVLILVBVNAUALFJQBAPYDMODVVXOXBKD HCMHAESSHJHSJKVXPKLP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OGTAMEUMQMASVROOFTPMWMFCLBPTSMSTODPYIXXK BPDJWZEDZIXLBTPIFSVHHVPIIZICPMBGYUSYXGSU DJXHDBKKQBGHAMAVPCXRSMOWQUBZQMMQFUPUVWLY EUNHCZGABVLRIGZDZWSGDMGXJMXPLHUAFGALCHTE JGJQEBNEOQGPIZEMCQTOOFLVSXILDVTAUKBORUVV FOOMZJWABXTHJHOBJAFMCKRBXASTEROYHFTIVHIG VQITRVDWJTHQUXFQZRKEWRRTLBMTETLTMRDRJFGT VAGWVINWSYHGRPPIWCTRRAQFBCZEKVGJDESNYGTP FHGFONPTCXTNWDFDAFMUHPSGXLPMBJOMWBRDNZBQ WQXLTVXMQCFPQTCYJVATIPPBHEQAMETUEMQNLNJK EFSWTGETZXSKOLQEIBOFWDMKREAOQWTJXEOOOOGG HLHFHPZIFDVAIEGRCQRWJURKJPVBBAFLRKPFOEDG TJKSAPBKAFUBUPDQMNNQHGOTTXBOAAGEWFXYKYSL MZCDRHNUNQXKUHYFZPPQZJUIKBVKBNBLKOBJABGH SZBOXZLJARXDNEBDCOBLUGKMTDVZQVKMHGOPHHRP SOATHQAUEKTGMWWBLSZCJAQYZJTGDUXCDTPYEJCD IUZEMUFNWYCWJDRUHTCLFRWEXZNIBWVNECIBFHNI XPWJMQBHSYALDPEQTZCPBSXKQWCCQSEBFWTCSVVC VNEKTLXVJCCCWNCFBISERWKSQBWBFEKVPQEHHACK HVTPYALPJESHEYIZXAHPHGOZIKGQLKRYCKINLXSC TOREEYRADRMHVUFKBBCGKDTQWXXNKUEGYFCHXABV PKQGYRFTFSVETNBJYVYBRVOFGYJLDCNPLGPCVRIB AAMBJCDKFHAXOUKEBLOIAAHVLOCTUPCVKIEBWALG EWXCCXHMPTNAPVFDKWETNNVTKOVMISADQTKLTJCJ IHGBBVAWZEJAHQYWDHQSXBKBLPMDDDBHYLGVRABC ARZAVIRVMKGJQCLTWKINASBGOYZTAIVXAMXGWVPD JCRPBTDQKQIYXEMHEFJEZRZXKDZQPZEAITYIZCMA BTBOBHNENHNVZNWORLCJBZLADGAMTWSSCESSQJVM RHUCLKOWRGTWRYAHXFCFRSGQZETPNOZHXOXYWMUX YNHGDRGRGPJCYAVWWEEMPKAPZAZVGGLAOIFCHETG ZCXIBZTFXNWNQQSCLCHOQXTVXZTNMBKOMQWDCBJK JMSYMFXKKAEZFBVRXWBZNQNWVGBFNXTSPUVLJGWE VFYIKHLEWKLNMITCTEBIJADMQQWKEBOFHQZLXMCI ONTVIRQAJNGBROMNJYYDEIDIPRKDGMURQFWXIJAT POANCUVFVJROSJORVBIANVIDLKFZAYNUKAAGXGVD VPNTMZBPEHAEHNKIDJPKGJSRTEPPYEBDMJDDFJJS JAEMXMNPUDTXJIRMPPAPQVQRFAVNVRMBMYUBHJPD QPTJSBWWBFWVEMYPZBUZHYIFHVHXASUJWBQEBCOP YGRARZSTKBJDHOUAFNLVBCMKWXFDYGQCZORMFBRV SHWPHWCJAOUOWPPKUIEVXEGDJLVMUEXYCVLPKTFC SXFSAAIPQSMOVUZTFLWFQTDCQDJCYZOGIRTKAMNW RYUBHQUTBPEQAZMICPGCEQMWBXJAFIRYUNIKHNRK ETSKEHNTRDZWITBTUOUYZZAOMLEJPAJJHXMHWEKQ PICNUZASMGHFZFWKKWUUCIJGYSEPEZOLLNNYFEXE PPEIMKMNNJLLLQIJBPSUBJVEOMZXBGIXNYPKTJBC SDLOVSAJQXTTKIVRYZRNAVSSFBHMEDNGOSEVKSDK MYJAISMZPKIMUJVILLUZGVGIWLXOZVMFJPIHIXRD VTIIQXRJBCIOLVFNFEQS
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SMANTNMZOGHWNKPFKAVLZAKEVSGOWAMFAZIDQSST SPKXRISBLTISGOMFGHIEOUYNOHFDYKAUJEYKJHAE IEQRBQNLFZXQTPUOVKAHXDWWLMNKXDYPJMQNDVKA ZQNWTQPEKJPXCIOMKHIBFGEJTGAKKAJVOPCCTZLC KXFKGDROLAPNRQQKNQPJZUAKEWSAMFKWXPRATBVN ZXGEAVBUKQHRTGEEECNLPLSLZGVAXGZJQAPAFZEV BDPFVWJFZMMICJJSXDOEFDWBSBJYIBXSLOLVUUAU YKOMLAAGWKRFFDVLEVWVDHVUCESBTPCKMLQCAZVC CCUFAHKMSYAADHBKWWDMUKKZFQZQESGHATOMXHSL CNZABIOGUJZAIRZJSHBFOSOJEVPRRQRCESSHCNKW MTDBVAVIMARODZNORSZPVETGDSTWQUNMRNQSVRSU LYUBRSJDIJPWZOTVKMFEBWDNYYEQUOJKXHTPNEYU RBDONJYOLOXXCCSEKPRURZNLCELMVHVXBSWUPOGS VPAOKCMAQUBCWTVTKBYSQSPQESLZXBLFOBHJTUFB PWSOLTXVXROWMOBYQTGLBGCURUQEACELTAEMJDBH ZBOWLTXLISMGAOPHQNHHFIRXTXEFPFFUVZSKZZQI UZSMVDEUCREDRAEQNSVYWWAHILFEHMDASUMASJOB JCEOVYQKQYYEDBMLQUYIXZFPREBHVJUELNZDQYFC WZVLPJEPMWADWFGYHOHNCDKTKJYHDJDZYLRMKLHX XKBRLZAOZNVNKOPSUYFJZHCRWCHQOFIBLVVEYWZK OAUIEZLMAPBQYEAVOKYGXLYIYUBQQTGZIHMRXUFE CCMQCUBFZNIOMBEEFOLICBOMULYBXVDWREFFYUOB WQPJMALLQHVFHIQKDXMXJKGWRDSWSNMGZTUTHCJY UNJVFCYWICXGCYNZJYGZYMYYSDHJXLZQEMMGHERQ ZINWDQKLFXRRWRWXOBAOXWDPUENGUQUJWCRISIGS LFYYPBUGQMJQGLAWTUIKZCWHANGMMYVHNTTRQTCZ OIGIEQMEBCIALOJOXXPHTDPAIQEEMFVRLOSPVYKB DPYCUGONNYHQDZKASSATDJLSKRZGZAMQGGMQJLLY VFRUFBQWVZQDNXDIKWFIQMPOCKCGFCUYZMHUPRBW HGHYHLRSYXMIBXDAMPHHAHWXJMXTREIONDIRSKHU KAROJVOWOLZGXGAMWNLSTTZMTDGONIZDPCGRENJP IIMTHODMZVKGVXZCVNNDWGAOLZIMVAWUMJUTLDNV IMOHKKTRHVNDWCWKVTVWDULLAXWXJQUONXWHCDZU LWRHECNTKOFJLSWLVYDSLZTJOQRVUVHNXOBPHYCR TQYRGQPKTCWWEHYSFUKJEVWVZZXIGHFWWBCYTTKI KUHJKJGJJKJWOCVTRKXHQUXZIROTSHUINIHJFCJZ FNVGGCNZVMORTKFEBCRFAQYCJIISXVYUZSRXQSPS XKVQQRCAAZKEQKXGSZNZRPNUHOAGJTIDIWOXDAXP TTBKLIBPJNOSSYDVRXZPRARILQECLTUQRNOBMROT AOEFNAGZLPCORHZNUBTRAASIFAZTRISDYQPTFTEG UVYEREYMJCAEZDWTZRNWKKRFEVESOXBVPATSFWYO HOEMLZTVPLAQLIVIJFZRBRWZNXMZOYYLKXYPEEFN GKQBAZSYSLIXFYRJNMCAXEXHCXPXECPPUNOXUZXP OLKPRDTADDGRNCRQEPIWRFOXSCXJIOPHHUQNHXEB ITNIQOBWQXFSIJXKXWGSLWPOHCIPVRWZJSCYIESH TSPZMMCJOTCDWUDRLMCCKCPCCERKFCUUBDENZOZF KQRVAIJFLJXXEEBURLLIBMWHOUYWWWVQBFCOCQYE PBRTHNEKLHGKQKESYHHX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YAWBABIMBKVKXSLMICYXDVYEQKVIGJXHSGSWEQGV QYAXRNAGBFJNZPRHRAMJFVFGKLLCTIONVGFZLHPV TIDCBMPHLTVTOVNKTICLCQWVVAIHTHOWZTBTBSTI PVUCXEPLDWZIYBDJHYFRQTCKRYTSXUBNZRANMVIK DCBMAWPDRQGYOTULGVSAXNAXJNHLBNBDBUPBVXHQ MKLYFNIDQXZDLXPAQDNFFHJBJQXUPDJBKICVIWOH PDQZWDSETVGIGTIDHZSFIRTBCHOHCTLVAUECPZJM KGHLPKGDFJWEMIFDKFEASRMTXGRRWRXKIIPIXJDF BRZVFFKOZHEHKJZGGUKIUJKMZSQTUSJPNUIAKNRL BXUBXQGWLQTVHCQSHTFHMUAMFIQURZSWXXMSNIDN NONAEJAMQHHOJSOBXUMQQECDKGPYLGLGGEKUVITH BBLBTKODILPAJBQLJKHKELFCTNJCWSCPDVKJIWFF RSSYGMKYTBKAZCXRZWHTEQDUVXRRZHVKJJOIFRKH SRMUXEWBSNWETSOANYSOOCJYWNNEIELTZCJLJCTN YESYLIENEFRFUXNXLJOFNJVKINRMORBXNPGKHVZB MQQWRYBTBQEHDTUIYLDBFQSVMURYOMTUJBVRBMKH JAQOHVZDHSKZLJDLJDJHCTJFGNCJFPTBFSYTIBMU HGIQLDXIKVVQLXCMPUVESRNJJOQVHDUGLOAJWTYM KAFYCHMZYQJIMNZYLWDDCTEPUIIUWXFYWBOHXGPO CWUJYFTRDMEHYHOGHZWZMYDKNNBYYROCOIFBTVYH NNSLSZDSRHCNSSWCGRHVRQEXBIDBRDZHWCJRJJFP WEIPXYAVLGJHPQJYNNGAQQYZBNVJNYPXUCMQBNWI MMXOJJKTDNOVIVKXHSGUGLVBHAFSYNDAYZXEXCME SQWCOGWUJNXGAMQWXSLXSTYSMGFBPWJDVKULMFEW GMSBRDZLTLAOHPSZNAAMKZBYUWZZADYWBERXCFRP OAZAETCTTCAKSXWWKLBRNXEOAPJEXXBSBGBUVXCP DIPVAIBPBQLDCJNCDNDLUKSDQRHLGMSKEEIBMIUH EEWGOVZKJHLUZXQYICUXTMMTVBLJCEFSFISPZZHH BPSLNFBOZSUAICHOJYBUEAWXEBRQOBPLJHADUYGE NFDLOELFRUIHLPAQNEXBDFXWWFGYLKPPOYKXJZSF CUALMRUWBVKGCMFAVBINCYCOYZETTRIAIZMCHRIJ OWVGVOOSPMFDIHLSZZAFIHRQFTTXNXGUKWPSYICD PMFBANWAFPZFWBEYYJDUMSHDSITESEDNQJBKKZFW FUAARNLYFGUNKHEHAETROUXOJWJWJVXFCDGJBDBT EWMJGBIUADAVVQYEKOOYRPAVHHGVIICTAAUQWMLR IXDLEACJDBHOBAQLFLXRHFDPUGRDYOJOYRCZTYKN YVUGPWTTFXWWWUMJGFDJALBQCBWZOMKUOIWGTQUR YPSUWIIBIGOPRRETXMJTIETEBFRFDTOBDSWXUYZW SSETSFZWCTSSMXLWTQNVCBKXIGDUGCZIGKDXMBYW YKYJTKRHYYOFNPVVVZGRPCAZOJWJBZWUXBEMJQXZ HAVGXDMVEAISVPWKJZJFJJGNUXHOXIFXKDKTLTVU GEUYNGUVWBDXJMLRYCASCZECZAZUFRQFUQXFNVZU IEVCKKAKQKHEDYPWOBLVWNPGDSXLMSOEQJOICXVU BVSGWEGQVXDRBLHPMCTPTTZFMXBYRAHYGGERNGVL IRKCEPUNIJFETTKQKDMPHMNQKFNRDDZIXUQJRJUG PWZZKWNGOCNTXGNUDDFHVWDMCPEKFDTFKLGZUTRN UXFUPCZGWVWUDGSDEMFLXHTOTUMRXVYETRXTQZDQ MOSOLHRJZXCMGFFKDKIM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HZSBCBSWCCLAXPATYOROLEIGABDLEUQGCWYPSVIN MISIIICAMZQPOBVJXYATBAWZIFFSPVKRWQMITEUV AGBZIMQTHNBWDQHBGUUFKSZWCQPBEVBLPITUWNQX YPBKNQNGCHIKQPXYFDTQMGEQFXXKXBOJVFPWCKTN VUKGHBYWXBWBFLHRUDTMXZAICRRSDOOXPHOJJUDA JCBQQMDMHSTWIQWDEJUTTNPRWQRAPJZGYPZWYQPZ HJOLIZHZILGJCNIPWOUCBNYFKBRWHLWFCYLJVIGT NCMWWRFPOUJLRKHTTYDYNWPHHYBIIDVOKQZVCIVU IAVLBUTPIKTLCOWUNBWBMTXOPZOPRQTPEWCWNWAS TWIKGEOOJETHWEHJUZXLEYLNHMNDAIIWPNINLJPF BKDYGPYXSWYFVJFCRMPBWUPZSAYZTGGPXCNDLXTE CYRUIXKRSJNXGZUTGBTGGBBKMVKBIMIYOVGJWXYZ VRXQRUJXERFHNPXBXEKZYYIGRWRQZSPBBSBWXUDV FZMGSBGPDFZQHGLZYUCWYEXETHDMZPAYZUBXVVBQ YLGYIJJMGPZTVYHPZPBYMAYFEZIQUBMHQPTCWIRV CGVWALVCXFIWISNOQJOFGDZEUZDYMIFJWDUTWGAQ QOBVMCCPOVPWJYKUQIRBLJOYBJYUDKBKJXMCQGYJ FWQIRXZGWCUCRKRCUABNXQCEKLYVJJKCVAKDOZVN SGFCXSPKIESOWIZQPWVWUHKAGQOPYLWAPBPDNKYZ DHDSHPJMQEBORFWYGYBPIHGJPPKTQJTVNSEBVDHA AFHPBNUALHUCIMWFLSZNGZOUAHZGXBXILZSNOVLU PMKMXRSGFYZTVALLGFSHJYOOIWRZYTOKKLRIEMTN VGFYXEQKKDLSETZHRQXLHALRQSQHFRQHUPFUMHVX XRQLJSOMSZARMSQHSJXYBFZOLUGXWTJNWYAMGSGR GMWBILBYPYCMZKAINCQVLEOTGJCXHSALRSQOSYXL HCGOTZLJBMJSGWAFLTEHKZGIYCNVTBXXJDRVHLWP PNVMGQGPSQTOTSNPKTTYEMVKNUWVVTVSDYMYCOIQ SIPIPOLJULFVGEGDEGJMMMJKOMBCJCHSHDAISUCS QDVESPXMUOWIUDOZUOHEIOGNADDDIAHYKDIHYSYU RSVLRGALIXZRJBOMPBPIMDCUUDFIABMBAXVHWQWJ OXEIREWTKEENXDXJFPXIBQYXWHEOPBHGNIYCIDBD PGVTPZOYIVXNNDTWOOCHTMHNBESQWPPQUAVEULWQ XGXDEGCTIRPJMWOKYKQTFESCPVKTQWHLBRFVQZNB HSEJVUMZALYISHEJIGLXCDWXBHEZMFPATIWEOKRL SNWALFNQTWIRWSTKNVGVESNHDBXHWTTXDBQBLRMQ JWAWVUEBOFLCISKKBRJXXZYXSBLZBUNBWCDIGEZQ JIODNFQRGCJOJPAZYYJZRMPODGPCSYQEJLDQXSMR LCVWSVTRJKLVQOHRKLRTLZJVPCWBWZVZONHSJHTJ VGUTWUSFYQWKPZFTLNMNSUHSKASXFIYDXCSBWOJF BWGEONIJUDZHRWWWKBSJRCEGAIVCPRUNPTQQZOWY SGPJGUETSBRJOIBYFKUJHKBJGRDTGVONLLALBVHR DDGBRQPWZDWMKBTUQEGPBMDYENEGNTWATPZJUPPA SNBGJLPYUSGLMUFZHUYISVXJNDDMMAMKSJNXQYTH JFXNZGIAQKPOZBVSSWYMNOCHQCSHVEHDDKWPEADL NENMHJCBHQXRDNNZNAOJGIKTXJDARFFKYCVWBMQR YACOZMKLKBHLVFJHYCAZYTTQQYHCPWAWDNZBTCXT NKNBHNBDRGTBEKYHBFCHZNJBHIEGWLHDEHCBFIIV DYHDRYDBFMTOGQNILKVF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KCQQGSIGCVCCJSVIFCQOTWYYYPXWIYNERTXRIDQV MPKABJBAZZNRAFJATNXDZOEZWARHMGDEHHWCTRWU UCLXCPLNJESKUPUTUERGNRUVIFMWHCVCAORTPUHD SLXJDKJOBSGSLYJJQPKBMXTLRQJHIFHXSJTCOPSE QSXMFRGRAOHAUBPHYKCRLGJTPVPAVKAKSUKNABMX GKWKLLUIFKTWFZMCKCHFADIWAEUKVYNNXVUGPYGT EWZHPDACPUHGDDGXDMOIZLWXDUWHQZIRZWCWRPFK WHNWWFYJHVIPPNDCLCRTQDMCLDOGYZRISMCQGSHV LKQWFTLYDSAXCJALWSCAZKAYGYGBKCIHMKYDDCKC ELYZBWCQWPMGGIXBPUCCRBFTXZTQRRJFGLCCUMXH VMOFTTSCHJXYLBBVLGIKNUWUGAJJUGRZJVPQLVXV SMONFNGACIQFFAYUSENQPTJMQPIDDTIGZPBSVNUF SCJNSTJFWXZCPIIIXOTSHYOFMBXCWQIJRFLPWIBK RYVQKDGGZSEYDNQQPQEZEPLCMGGUVOWISUHPWOLZ BPTSSQRKEAKXSECSGXRYIKDQBUXWKKSBJXVDCUMT KHLQJIUGGJNSRQVYJFLKGTVKFFZWGYTMNQSRXHUX YTRNDQNBFWLLZOFQXNFSIVHEDOCEECZIXRCMYLYP FXEJZSCUYVTWTHYJRECVDHTQMDLPEIDQRWNBECCD BYQEGGPWUTPJHRJAFKQZPCHICDMPZFRMZQMMYAHT HUUOZYJGRNQJPBJKMJUOGUIWLTNPYSOBRCNCZGZW ZZDGRRXMKXFRJFMECLKMHIPJUKRQSLECHQYUJSHG JLCLEPEJGOILJLBGCBBBYQDIYCUJPFFOWXZAUTJP BTOCIWQOSDICWPGEMHJNGUDZXTVURJLYPPWZVVOH QCANJJJKRQXHHNNCAMLUCBPMJQBVFYWRJGQFVUVS SAGTYWXDABTCNHOGSPGKEXSPZSAQOZQBWTIJKSXF CESWJCBJTCPEOPKXCEQOPPKSRMSODHNIKQUDBZGI MAQTBKOTADTWZUIEUNHAHOKRCUQVWMBYJCDEPGEB VTFURAGMSVCAACUPDECRMEHFCMXDFBKZORJYZPPU JLTDRJZCVEFDELUIJIZFVEQPHHMRMVMMTHSHDNDJ ZLBKHYTDMXTPFLUYIOSGEGBLNCDKPOQADEAKCGLE AHOIYEVDADZSPNYRIJFLDZKFDPCJBNQRTGOAUNQT FDSVQGCIGEEUIFMOERJGDOFKOPOMKMHUGOGYBSML KDDYUSLKOBPGFQKXSVAXGPDXJPFHCKVRNNONCMCQ RAERSYMENTNVKJKIYPKZCGVLFMTVJWBWKJDOSIDJ NTEWCQMVIUFHCCCIKIPKWIQFXSBRUYSHRLKGAWNL XUWVPDBQJHZHMTUOCGYJCQONVMESSZFZTRNLKYTG KKOTAYRSPBISZHKEZRIKALSYKILLPPYAHTQWJJRL IKZFDLVAGYMEPEUEWNVKJLRBHLVTLUVBTAKXKMES BYSMHXFCYGNTTOYDXKXTQLNVRWFMLVJYVMTSCGZK UVHXSKDYHDAPWGKCZTOJNAIEYRESSXNVYSTNXMAM EGWWRYQHNHGEGKFWINUUYXSIXDVCHDOQTZRLTASS UVPVYQIGKIVVWCBCNZHZSIJEAAIQZPAAWCXPUYLX INMYRQTTXZPGXPETKHHFUEFRYJPSUOBQYWHFXIPB FYPKLQYGLTAXGQHADMOHBNHTSWRHAJEVOEXSAJQM RGIUUPQWSJDCFMAYYUPUUAFTVZLSPXSAKXYSRBQM FUBNTAIDHYDVUJGGVOEAZNNHTFVZKWWBJVTRJBBY TYVPCIEBEROJHBKVOUAZEXLSWLDNEMNQJAQPSXNJ LKUJVIZICQPCOCEUNNPR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JPXLOZLZSJWZEFZZCAYPOCRBXFQNUITNDENBYVJM SAPZYEHEXHTXXLYZMDDNPZZLVAQKBLEJSWTKFCWA YGAAGPSDVDORXBIMXPGCBDUNRQBSRSMWBZXYSSPJ ZWDWRKGIPGBPBJZYCYSNFPBCGZZVNPTLYIQURCBD PDPLHDSVECNUUFQZZHOYRAMAARIZPQTFTNZFVGGO QYHEKLSFAGQWDCNKSJRLBKLYJAEPKZNDPRAEQPHB JYZNMIXTMLCMMTLFPSIUTSFYXRWKYIQBAODAPPPB IVTWESNFAMDHOIQJXFTUZVUPBGZIGDQEOBGAWGHU KNJDCNKKRCQBVVROIUSBEPDZRSISTBLIPNIZASOR MVRGHGRSYCIWIRJGMLQAFXVENCNFUOIUGNKYJWFD IFFDSVHJLVHMXZCNCVHNHNJKJPEUVRXBEYLTHYUT IZUXKPPAWESXRCEHSQPYLDRFDWTKNYNZYSYSJSDK KKXEUDQMVOJFAYJHVBICECPFDXQPNPYZLGJIPUPY FBXSLYZWVXNYPPYQBLJILIQZLAEVPLHQCDIJYEPR SNNRGELXCDFIYSWFJFBYBOCCPYWKMTQEGLFFSPWT DDDABMUUCPXUCTAHPQCDTULFVMADZDVNXLUUKZPF DYQOKXDHCGPQUTWUGCLIHUMYDEUWJADUKQQFNOAC HPDSCINGJMFDJSYMONOHJFMTYWKGTIXUVOFQRWVH EFSYXBWPOJAFQKEBXYAKIUAPVFBKTNXBUJRKXKKW FIWGXAZZYTEVBOUJQIMPTIWOHQRINOHGOSBFQGVA IOPQQHJELIIRHDAHHUHHQMGHKCBDIRDHSSEVXEKB EKKPUVVMELBIBQQWPCFOIYGXLCHWLDPSYZAXYIFS QJBPDOGCTMEZRNAQTCLSCREQWYKHCTOQWINDVQMF MAXKYPUCOPLCVFSVKYHDYQGFQDNRYSTOIXNRCKRU NQYRKIVTYDFXKEDFASINXEFELXWFVWCHZXIKYWDJ NWKPABNKKGOTMBKQRTXAOVINSOQBTRFPEFVFOWHC JNPNSEOBVDPJNTHGGXWEAPPTPJHDZWBGXFGICOTZ LNBWZFLKWTVXJLGAUIYQJGPDCWJHPEVZLIRRECCU JOAJBPQOLXVMUWDDJTTWEWNVJBXYUGDDZEYGZJVZ NBKYSRHYMEFYFMJMSMSIXLAFQBWMFOSNKRMEHEIF AOIAWDAUKDYTZCUFJMGYVCYROHSDRRDMFHPHCBLH TVXEKEXKMVMIBGBJFYVBQEYTDQXZDPOQIEYCGDEN MTINZEKYUGCTKEITZUHVAYUSRCDDIQZEKWKHHYUU JKNLKRJLNZRMWTEGMCFCFSVXBYZMBUVGJPMKLHRF HKVEESHQDRZRMBJWPNQHNAQXIQHKGNTNDLYIUASD JWIPFUIYXPFQNBGJFMXZBJZCWGEEUDHHFGCRNQLO ABLINKQWHESEOVFSJHEGOOLVANGGMHUZMMXIFDNB YZMBYLPCNTTDKLFOLEOLPLFRRNQRFVDDSUPCQIOR FHNLCEEOWDHJNROTRFHRHHKAPCDECEJGWVBLNOWX HOCLERYYHNSYCYAPFVDDBFTTLNIUZCLCKJECATRD RNPSPCADXAPBSLWEKDBVNYPBVQZKHDJIENVXOQRU IVVPVPWJMGEHZFHIEKJUFILPIQHLYLRVEDZYDCZA LDXZRLYGTQWJGVJDQHPDWITNNCZUDODITENMMHRP ODPXKIZSCTDTIUPDKUWXNOJUQBSUXSVZTELWZFUE AAVKHBHWNNXXIKZWPIBSSIGVLRQGMYJMFOGLYKIM FUBOKDIHFZZIBCBTFQADOUSGEJRIPPELWVBAJCNC EIFBFKHJHRHGMQXYBLWIHEVYNATJMQHPRMSDKSXZ QUWMISUSPIJMYHFRONEO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NGDUADCOLQEVACDWWKQUUWOQWMGVOTALKZHUKEYS KNPUZUKOHUVSHWVPVWUSDTFNLCVRCUARGMXIDUYA LRHJNGACJODQAUSKEXDQOOPBHINYMXFIXDWTUFTF KJGGTXRFJYOMUIRTGFALPNTHLGGJWSMGKWURICWB CZLPDBZQRWCLNJPKZYWJPUKEGDTOVVDBYRCHESVT NZBCLGEEKCLUIHBJZWWOVTVLOVLJBJDPZKDSLSDA SESBJUZFLMZUIWWGOEPTMOBXGALYUUGJHJCHLTVD KFRXLOJQMPGHLLSWSWNPYQTRKWDRRBWVPTMVVPKA MJQPKBZUTDIXDHKUFJLQXXIVGDIYOGYARQPEFSQQ QNHJHMVWYGSXMANWVJKSNRREZNANIVMVMAJTRUNE VRBTFHNKSTSUDFKVKCHRPUEYGLTVOBBXJEGVEXPL IQAPEMXTELOTXZEQJUAVMGXMZICTKBMNFNJHKOXB JWYICWJOMWYJLUNMQEHMJITLNBIDAZVJORJABAOX HEOMXMHVMWDVVSZQEUWYRSEOHXZPSGWFAXDIZNCC BGWGPMKAQKHCZKYGRKPONHMTAINUCYPRVUGXLARH IMLJQBKHXLEKWBEEBXIOPAAIDLTRLBIMEVCSSLXS QJPCMOTRJKEBVGQTRNEHOFDKTFAZPZMKZPOQEWOO IFTEPQPQKMWMRWZNKUOTYRUJDBHXTNMNRCSMALRT YPAHDFBFOZMJSQMJVYRTZCRIAPLRQPCKWJHZOEXV FWFHDDPOWVIKZVERZLBXQTGLFQUZWEQXOORHIGVZ FVKSQVICZSWITRIQGHECVUCCAAQHGOEXVRGLVZHZ CEGXROWEJIZGZCXLLKRLYFYQVCQTGLTGQHWJASZM AQYRWGCNOCSPYFZPQEHTMGOPCLFFRUETJDAQAXAF PUTYSVSYMIKPHBAFQIREYICUCVYCRXVAYPPZTUTX CGQOQAHIQFHXFNWPSHWKZXOCRARMDBTEHOFMTTJE NOKGHZCMBLVJAZXGSEOJOVKDJSCUSUJLIYAJGIAU ESKWQHYDMXLVRMQDCOZUBDDHTPYURWUJLRAYSWTN EQFWERCCEFRZZYRKVCTXKSOWWFAHVDZPGMLCOUOC ZUIISCGNGBOJGIQKYBNHRYIEHPJXJGKGYNRZRVWR UYXAHLPRWJQCVFXMKLYYGQBKNJLHCBEQMXLBPNNO YZHNJZPBWLAVKWFXOYAGNOCXYNHUBTKRSEGRADWJ IVCGPALPCGYAHWYZKQIGLLDQVJNSPOHIYPRAFHWS EAVKYERVIUBQEMIXJZTOOKTGDBCXPHNUNYMFUSJV GDKPYOFIJIUUXBKYSLGRAOYAIWAOODOCASDLWJBY BPBMWVXYBEPVFZRSOUNGEBOOMASEOIAVNOSUBPXT FSUCEMFQPGQPRDDCEMRHDQSGEAOPQSXGKHDTLQAN PKYLLEHDSGJOYAERSXJTBCKIAOUGWOBYGSWXZLHQ GCZQLIGHGEJDGRLIMCNFXVUCLWRPQDAFBGGITVWK FANQNJORSSWWVUKUWRNYMGNMOHBLDAVLAQUMAWXC OMCLBSDEFYZBSWVTXPSXPWFILFOXLIHGXEPJYILZ SWNCRAYSXZIVIJGMMZLZWRMOUQHQPXPYIFXJCACK ZEAJBQCOOIGDCYXSXDVYOQQUFFWWHRTACGPULEQG TEYHJTXWLTCRDIHOCTXFCSTWZVQFYYVVUCEFCFYZ JSNFWVAQYXOWODZRIFZBVZXAGKFCYTHNKAMGXNCL GSDQQWKYGLIDIPXMAHWSJKMMKNBDLCMKYNDVENET ADDRJRWZXZRYEMHCCWYMYFMTMVLMNWUPXUAMSRBB RUTDDOCEMDCTYOANYJRTHWIBOCUOZWDTUKLAARCB FBGWMVZYWOTKJFZBEQID
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MVLKIOUQPKORWNGTVMHIEEEDRJQOYNPMECVOQELT RIFOHLZHPQZIUAWNVPDGPXSGPBPYBILHOKLUXWYX NBMSQFZKOXIQDPFFXQKJDGNZNIDWWNZGSMHAPNZP UGBVXBVXUFIEGZCHZNNTLLZVWOVFGAYIBLVRLHEG BYPREXCMYMJTRZAKFPUFFCFXUCPZFMODORFDCLTY OECIYCZVWINZLFASKRWCLHEOVQEHQBIWJLFUUTTX RAAFXTIOZACWGZLSJEGRQBDNVGODZHKVVWYSLPSD OIRZMOLVXLFATCXRAFPZFWXRFUHNLNNSPVGNEILL WWZJJTSPDUPUYBCIDBGQGIXLILOEKDMKJRVTUQDR PXXGTHKLHWCOIDZSCLCORJILLLGMDSODBBVVXDBG NMAIPHXQKQSMXYHFKBDDLIDYJQPEIFNIFNZXXCNI MKTHTOSGPNIVVASJHRZFLITYWVZRMRIWSDOPHLUK EDZVDHONDOLSXCMWPRJUFRHEZRTBGANJZUNSRUWZ YCHHLHUFVLQATBUODQLYXZGSFHAYSKMFUCARNMWS MNFJWBEZJCPYCANGFDUEMOAGMALYWBYGALFCJMWL BTRKFXDIAYDXPQTGEQGBJBPMSWUADCSMBZFUKGSQ PMAFBFLOGQULCXDJRDPHMZKNGCPSHICXQFFCQCUT WXJVJRWQSUUJOXXONAAKVKEHDSEOSCBWFTRRDYNR GOASFQMYFMMOKUJIXTGLADPVGDRIUUXLETYMMZCE JAOXUYKBFFKAJCJQGYDSNZPFMXCZBVJNIWHOTBYJ PJTZCRZNHOMSGLQQCMUEVTSJQSRGTFGYFTDVRTHP PNYJGZDIGVHKPAYXSRNKQZJCZBXJPZVMQEWDECHD TJHVVNMZHNVFOZPBPDFPZCKGGNRCBRZJJWEGFIJW BRKJKHOMZMBEITRGFDSQHIXCPDKXHSQNPGMSNNGK KILRZTYGTWDPZLOWBZRYMUPBMBVBJUCBVQLIUQIM OXDVQDLQOSVXRBJRSVDZYORZJRNGCJDQVTLKSWBO BAQNIAFGYEVEDTEVFYVXLTHXOPNTYBNCLERBAEKC OUKVWAOELBIDWCFZMRRNXWZGSYVXXFXIUIJLUEWO KPODIEAWBXAMISRCQCLHKGYRHHMFVNKLZVJYQFJF KPKJNUTHPBMVWFRKCOMOWTDBZUDLICDSYQLLRGRT JBCABPCZCPZCKUGYVXMLLOAYNZIMDCFLHFMMCVUV KXWMSZFMOLPOLPROVWMLLXNYICXBMEXLQXYRWGNS WLXEBNCTVOLCWHAUNMMNCVHMHVCMBZCYWWWYUJER PRCFNRIXPEPBROGRHJLFARRJCHHSOYZYMRCIZRYT RYGDTLNZYSJJFHGSIALKNZIEUKTEMRFADTEDIUEN RBRYVHCUTTONSDHZQISEKWMIKZCPRLRMVINWPNIN TOLQBWOYMOZEKXCSLJYJVHTAKKSUPYPPCJJSQTIU OFAZPLQRQFZJNAZJXABRYDEWVVESRIMRPKSBUVLC EZVXHOLJAQHUVPYEVQPTSQYHSSSLJOOCHYEHDKSQ TQGJQEFYISCNFZFRSKIFEUKKBTRHRWPDLBWJDOBB PKGMYGUTBIKCEYXVSRWMDRCIDUMMVKZXHWGRZBHP BUOGCGMVXNHSOLJPWRRXIFOXNDUYQOWQQELTDDJG CLPAEQUZKGAENRIOIXPESBDOVINSMKIKUQGPKSYT BNNERVUIOSFPWPCIGYSXLOUZMMCGBYZDWGRXLFXM LQOVRPUXEJRMJZMQUZOYJTEUFTWNCHTBKMEKSUES GWVKIAFDFILJGXSLGTCYCFOMSEABWKAASPAPQEIG NOQINFQDBTUDHLTLUZHPZBTFSDOZTEGSSNZBBZGA JDFQUIWUMBGDSLREPUEN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MJGFUWRZMUACDMTZGYUOGFWMBOTRIMSOPQQECNET AQFTNXMQMCMACEEAZJZZIAHGDWVPSFWHXAYNHVXQ ZCWFXIHUKLIHMZCAMKBGGLFLRDYGBLLJQBVRISOB TZGVKXCQVPLRXCMRDGFTDPTHKEDENLKFNVZPBPAF IKACUKPHESWUQQQWVMBEBTSMJFLWRRBHASJLBXAT MABSVPKDGUDBBOOLHMGBAEYGTECWDBSIXEEVFEQG ZABAIPLSBNVUCPCRFLQCWODOWUNRIRIBRNMMHZJK UEAGBDIVZPWZRGEJAZYQEBUXDEMATCITOGHRXLZW YAJEMVFGFUDXSLEHWLEYCDQHYTZYKWLGVXTWRPTB AVOSTTIKOWIFCJZMBWPCAHSDAEGRKVOKAWMWVLUG YXQUKSFBLMWQHCMYZOLFRKPDIVHHXNBJRCVDEDHC MBWVWUSKNWHHVFMICYUAWDYIHNAFAPRHSUHPBNEW SQJQKJGVRVOUUNVMOXKIQAUWHFRXTZZNSOEXZJRT ESYDKHZUKVVJYABEDHSWVLGAQHOZZLKSAMKWTHFJ FOQWTRBZVAIATUMDQCGOROIRBLCJRKCGEWMESCZU DOHFMEEOHEEBQSEIWNHTFCQCRUAHUDQMPWSCIMDK UEQWZWYYLGUUNPRRNWLDNVKOBLAIYMGCMCNGMFHL XOPJOVPVCFRPFKPJXFNDHUICBNMFNOKGKCOGKMOV CJZRKBSOTVQOHLAFXYVHVUNYTQVFYWFXPXXXWGZQ WFZIGHGLESBUYYXSOXJALGVTPVTBWOQMAWXLWCHX JYVJLRULKOVVGNIYCKQUYENWBUMHJPYIMKXYTJRD QMZEJTVQSYKFKMWKXYNIOMUAVCVZSSIKXQYHDLRN RJTLJUMKCHAHJNPROPULVJJXHSEWRRKRBESWZZAK JWEINNOHAFUCWDKFXWMTILTIVWGNTOQDQENDRDBC LINQXYLWSRIDYGBTWFRACJPXYMIPXMGVTIXDRDDQ SVNTULIABHBRDIXBLIZFDQLPSQOXEWHICFMPOUKA RFXRLWZJLSRWBXYPEZIRMOMANNJULQBHMBJZXRCK TEAGLHPIUQZMPTPVZGLJOSBEPQHWQEMFBWPKTDUU WVGMXAXPOKIDCNXWYAVYWFOGJMBEPWDVDGFJOWRP TTANCUISPXMDDQKYIXPCOUOHRGCSRGDOBQAUNGZK HGYXDSRQJRUMHCUACOFNFKMCQHASGIWVMCBFAVDO TJTPQMFFYYGWQSVZUHPBXUSNZJSWTKAZCZKDZLJO SKVTQCCYKJXJWUDFXSTTGUXPYBIPPGHBURVFUMXY PIWZIAUAAKODOTGKFURVVTVJWLYHQJCXEHTWMBOE AABRQLRZMJEKAQMXVETNWNTNALYZAOSKSCMEYHKC WTUSEEOZEAKWFCRQVLMTITICKKSBZGDXFNNCDZPG ESKUDXMREZGVPHQWCOJWAUOULXCLHWQVDKBULDNW TNGOFJBCVUFWXEGLJVHHAFYURRGELQSTWPQQXKAH WJJILYPJSMZIXTSTTFMEQOLZUHCYRLXXWLJOWSSG UGVLUMKYNXEYSGABGJDSGGPESCUVASCMHXCBPGAA MKRYZVNBPHGSURAQVEDDEJERYOPRWGCMPWHFCZYL TZEZLAVVPMLPCCPTJJTAAKPPPFLUJQDSZLAGBEHM HFWSBHJOLCUGSOHFAZIOWVCUKWYLTLUOLKBUVFKT OIDAYGTMKQXHAHYKPMXVIGPQXOSZQVNINXAXBCWM BVUUIUBFMITOAFKUPPVRWBPPSXJSQFMZPGHVRKKJ MLBZRSRIACQNNVRYABNEDWRKCBBNDXBPABEWPDFR IGRKVLQEENODQCVNCDDRFFYLHHJKAONGOTTFHDHZ AHZXKSJONHNVZIFGNLGQ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SBOSPDFZWSAZYFHANSBJYJEUYIIXJPWPPEWKAVVL FNTEGCPLBWTMJCHLXDTOOKDIPPNQNBLRCZVQITTR ETAXYQCYLAHTPRACDXMAMJAHZJGPOTNAKNVWIZJX JFICWHAUFBPEUYWDQPRYSFTDISHTVXZUMZVHAOOD BXLJPJEEJFRLHKLKLOSROLAFZSMELTJOCGIBOFVA OAUFAAJMCNIIKXRNTWFPAJWXNNQKZCQEYEPQXJTU KNBDRTXCQCILVLCIZCOTYYOFDMCYVZKOJDGFAIRY IIKTCMXVJDZIKOTFBALHWHQGPMRGMXNCJHYEKQUM SBCRUOLSZKOTIPNATBCKASWNVDXUQFZUOFFKPVOY LVUEQDEDXIIUYKQICMZKZIYSJKCTJRKEXVPVBRQH SUSQVRXUNSTDXFBQONQBAAJIVCOEVZSWXNSBNXEH QQAADCBUCRENHAVSMRWZVGDHYHFBBVRMTFMIPVGU PFIPLRJGDYTBKNHEPSYZDTSSPGSKNYHSFDQFWBUK EGCOCHIPSZDFUCXAOCZUSJJKXWFMOYOEYFUOLWRQ QGPLXFBYRUQOJLREHCHMLHGBTTJBDODOTJRZGWRW GJZYOBOXRQFLFRMREAXXJIIKFMSSBZREDFMZWISG ZLRBLPNWOOOXPFEQOIBGUFXZMOIWJHVWBWARNVSB IHBLCGZCYPQLWISDSOPMHVIVIAMCFLVFSQYJZUWH VNYCVCTLDZDHIYNEGEDOFMHDHHSJBDHHJTYGJDMX MKJULWVVUVFBMXHPINYHBHMWDSQLHRIRSIVMKTTY FCSLSHQSDUJCWVEJMQTDNILWULUSWGCZCOQBYTUR TGDTMZDCUFZDPACGXXJWVCJNDLFXLKPZPNFOOTMT QQMHPKBRYIOZCSSQESMPZHPZPDTZWTDIRARELABD GPDFFQONPYLDCSBVVYRKVLRCCZYBBWWTDVHRVWQX NYLOHRSJPFHWKXPSMMVXIXFQWZCEDNOAPIZDFUZB QGLIUITNWRBYNZXPEEQZIBOQAOGFVYHWPBMJUPCO YPXWCKVBAZIMPDKYKGDYZJBDSVURZZDQIFDZLQCK TNXHYOMRZWKUXDTZLYFKIGZWCPLUSXZWWBZSMZJW PXCUFPUNBHLQTCCDVYXLSNIZKFEOWRFPRVTYTSMQ RUOWXQPKTEXXPDZVXDUHGMMFEJHISLBVFTZVFJNC PHLRUYHNNSVZDFUMLWNASAKHGCLISRIRGZTRXZDU UHOMOQOSEBWIGPTUDBGFLBDTMDNHYBMSWFCXEFXQ JKKTKQTMLDXOFRAGYLSSWTDHWMPGGOWAGXWFLDLF ZFZRYHIWCJUWGEQQKPAOWFBRRCCJUSDICXAJNVPG DZFITWAZKAGAMVMNUFFJDDHWGFKNFJGOSVJSPXXU TFDXVMXLELJQLXUQTNGDQNCSTOCSOFKSZBIGJEAY JQOKAKDCXWUSFSKMVWAWHQEZOWBUOQJKHIZJZBKA FOHXZWYDIJTEZRHLBWNCUCEGDBDVELBGBXHGXTNY CZXZKWCDHWCENJPKQTSAQAQAPISCFMMXELUUALMC BYMTLRQOCIGRZNAHELOHFWPFGQKNLGBRUKPNAKPN TZKVDJAAHCIQREVKUJGXSHVFBPWEDBYCLIFCOTSN ISQPOBCWVVCGAUBSXDAALFIDVMZYPVIWTJJLXHKX HQCAYDDLEAFCTXFXOWZWAETEHTUEZMBQCQQHDNTJ IIQQKORSNWLQHBRAPTYLBQCTPUKCDXGDZBXTIUAP AMSODCOOBSWPTABPZISNDNGQYLJVUFFWUNIXVBVX WVVYLZWLTBUJZHWJXCDHFRWEDSJHZYACJTECYIQK FYAECCPIHPRTJKNZAJFWMITAZOPPZKFKTGUHQMLO SCWICVPKCIQWPTPKRTXH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TEVAILARUYXKXTYFQHNFWKRUUGXOFCCJQJRZQBDC GTTVUHTXKRHOIAZUFQMCTCCTGRIXDLCITJPMFQYU SRDYDLBNIKOOOWOVWZUTPUUHNPECFNSNMNBUEYNO XZWJZUZTXILELIYOXQLVRHXMMUZVLFYZOGRQTBNV WPVMKOHSBOMVKXYEDGABLBZFUHQYVTZMKHVIWPEG JKDOHKSEKOODZWSDPIBPETYVXYMUEAJPYIFVHVJG TWBEOQLUDOVPARZGIMCIBISVCHVVKYUSQKNYCXOG UUDQLLUWUAOEKDXRLDHUMPXKNRWZZGRCWVASXRAF FKYHLRVKJATRFEYRBMYYKXIOPJEVMTDSFNMRLMTN LGYZBXCJNKBCPDFYRTTXLAWOPPFJCYDYTLJSNXRH PYGYABCMECEBGOYWUVRQUOYJRNQZWQNRZYBXAIEF OKYJBMRRKBUVLORMZLPBLOWGIVEWSHALCSKBZILV KJSXHUGRFBJYDGZMRACQBAYTYUVQHABFOAJAVFWT CQIGVVEAOQTAKYUSJDERGUBLWAMFUSGXCZHATUWT IDAHYWYQOAPJVDNOJWPBZEJLLQJSIOIWWYEDJZGW VQSCOYEGJGXEBQTJTWRNAGWFDSFEPPKBWBACBXFU ECPXVQQNSYBHWUACWNYYZCEZTYJFHOWMLVUIEUUX MVVAGCIHMTRHBZWIRZFOKWILQHLKFKXDATESWBAO WKYHYNWRVYVBXRYIASLAYRSEYTSIPODCGZWINETQ UALQIYHCCLAKEHZLFIBZCJJKMVOYXOQOUCKEJMWV CNFXOIWDJJVLYAHWMVMALEQQMWRUDZCANYXIJUYD WRNLLMEQBWTRWZXPSLNOSSACPWAQGPPXJKMHODKP DIWDWXQWSWZFFFOUMJHKTRUARECFWKAMKEMNXSTY GYLLQEPBBIBEZWXOAYGENQIQVUNEOWDBTDSCZCGF FAZOEYDWXIBSXDPANICQYFQOFBRTUIDKRKHHDIVB LLZMFBXWFDHIHBFAEILKIQNSMVFGVOSZQIALIYGP WPSZYGTCNNATXSEIYOYTVRTJOYMGSIYACVOLEVWP FIUAUBXXICKOTZQEAHQYQELNGBYIKVRZCZRKGIHI OWBNXDUVCYPOWCAQRYXZNGFPYHRDYQNSAUOPFGGT ALKYXOSUKVMWSGWYJXKTHHKOOMVHJUKKXFDWVMUG FFRKDIKIHWYENIMTCGICFFXGWLNFWDRYLJFXKZVK ESIPRLNJNVWYAQUZUVVPIXPFLASVAMORCTJBEMWY RSUXSSLJMESVUXEEHNNNIIRFZVNKYNHHOIIFGKQQ BTQMXNAMITDAMTIKXGCHAPCVJHSBEGEXLPKWCWHS KIRRMCRVSDKOQFXHKBBDWONQLNEDHFBGJBLXFPNJ WOBLLFOBOCKFYUEEPODUYTALMZREGQNGJGYWSLDJ RXWDILYGVWSTZQSJXSRJEFYWSSBHUIAZGOQXUFQS JCLVGWDWMHNZYDIEMUWMGYYRYQPDBRJPKQOXNYQI SYERVGVCRXBKYMORTDRCZGYGZQUYNYBWGACRYOUS MMALMIBEVZDOSLYZDNMDQHBOLNZNOELNKDREJNSM CPSSXZYBJPSSPCLIXOYZOIASCFTBUKRKBTPZMIHS ETVTNKGGGWNBGHJZIEPBNSXZUIOBQXZPCZFLLSYQ DNVQHRRHIZDYLOVJRANCJXTVYKLBACEFRMIKPKMF SJCXGRQBJYPJRDDPBLRFJQEUVSJREAXTLFRKRGEV JYVGDPKYGMZENHNITHDQMEYBZDPVDRLZIOCXBTXZ GYKBDUXSLHNSTOHAKUUBXRXRCOITQVWJJVAPBUAV TZIAKQPHVBKSKZSCGFVFRFIVDSZOKSFYJZHJSDVE LLYVTSPGAADUXSARCTFB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MEYJEWJTNJZOLTWZZCYEACDNERFDBOGUMGVWCWWU WOSPKHKZYUXCMVZUEOZHTISLVIHFRXIDQTUQICVA NAIHZRATRRGLTUUTOMIIRDBSEPNVXUNQBNTVAHAL VZEWDNZDGEBJTCIWHBDCRRTILDXMCXDDCNVEAKVZ SAVMYDVCQMLBJDJDYFYBDBXGGXEGECCPGBBFCOLL QAMMCBLPSIXHJHZJEYFFVWVUBBWOXLABOQVIDTBA ADGNHSNFMQYEFUHBLLBKFUPJZGFFSAJUQAPVVCJI TIJYMHBJXEHDYMAEHZXYMLYFQRBRFQMBCFIKSJBP NRPALKGNYQVOWZYRVRSGREOAEESBENPDNFJULZEB BWAKCLCKWDIADDKKTVZVGQUNFBODGNCGJFDLRYHF NAJSRDRBUIMUSIRGQLSACWYMNSQAEMYHHHZSRKRP LLZOGXRDIUXOXJITCVAGMSRHYBOAYOQMMEKXMDWM HTVZNTDSSOUIQDATYZTYREPMLMWMABUQLULEDKKE WILKWKPMAFYOLLWETYQZTRLETDFTPKDIJZEHICDB LTGOPRYUGAGMHMWEWHHJCMNWEADREDQRIICEVSSF LZVXTSMKBLTHSFNHUYQDJZXDVJEEJSFLPHKGUOZT ZANTWVGQGNBVNODNBLVKAKEETIKATPFXJRNNTPSW SHWPKSJKIMPDBZIHSZYAQVDXVWTRHJNAAUNSIDVW QSCBCYTNSZTRFKTJHDBECQLCXKNFBHHCBUEKHFSW VXBMXKYXGNSSYWQJRUJDMDKDNXYOIKKFVJCJHFSE NGSYTUAEWNDZVUOPCUDPOLXTDBDCFEFQMADLKKFG RMVDMPLJCWFVDJARGJARJMQUVEVGRDLPOEKAMGMB BLGZMRITIXCCBHHNUZBWKITQEAZELUAZKISOCYMG QWAMYBPLVMYKVYBVOAFJHEETXTWPROOQOBNCRURR BXCEUSILARFKOBUTATUTCVJXDBELBKZUCAVLNXJP GXKUPYXCDFNYSSVCCWZHUWADZCHILVQZVETCFZEL CXOLOUOXQEPXQULOPFYCIABIOLURJOMNJEZHJQLA XGLIBXLVRUBXNTEOCWIHBFTRIGDGPEMENCYXZQEL QDGVCLEFYHMLFAJXQPGTCQJOQIMUHDCBGXZCGVYL HOUXGZEUPZVQLWPKUXKKIQDYVFXZQBVQSVGDXOSF KRRTIRQKGKGFBUFUKHKCZGBMQLHSTXAXSUBSPRBJ CNGYZVZNWVSCCRHKWGJPTGNIVPYKUCVAHLVLGNFV OIPVQCSZLTFBTXPDEEAVJRAAFPWDXAPFDIDIYSKP HNNYYDILSLIZYSCEAQTMLUGPDKDRTBUZHKRYUFNM HETJLMKOKRGRVEMRAEPBHAKWXFXSBTXSKGFOCERP ANWCVUYGOLHIYPOYXAAOUQLXCGFNROYEXLYJAFAP NBCMFJFKYDZKBUMRFYDBFPEQRDTNSAPWEQEMHZDE KTFZXRJUJWCSDAUOEOOFZTBKPPEFNXCSQFDRXEOF YIFQXVIDKDSEVPKGVUBREXUDVLTLBFBFVHNENSZT AWLUDNTDWQHXCZTSISQKXGBWPJVXMLBPPXULCQZO LNHPQSBLKHGHYOUNDEFNETKWEXLZWJYBERSMWPXI DJQEPFIUMGWVQKDSZPSLULEZJDQHYTAJYWDFPEVG BAUHWXXGCIONFOABNLYUAJDXEWZJJHNIDHOAKJDU GYRRDODIQPLDUAQIEQPRALXFRYHEAMJMHTJOGLGM RYDEXPWEKXYPSIAEJCYLYPJAUEJDQJJJXVKQXLYY YRMOFSQWWMKWLRAGYQKZVPEWRQVPZSKOUSOMJOWX ZLJPRBZXPANYBNGRHUOVBWVHZQZCGGFMLVQYOUVN CIZRXCDZDXTSLRPPQCQO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TNIPFNEPBDKUUPCKPBMOEDMBJLBLMPGAXWJMNOOX QMHCEWKXPROKBORZFJBHJCQNQRUJIIRDHQUHWELT YQGYFCXTAFYXPSLHZSULTKFOYNAMAMWSBGSMWYTM MLGMLEUQCPKMHNTONXIBYXPXTATBLMGRBYOKNCNS LNPYUMTCJSLYDYVHHHFWKCKMZAGUIWGBFSKXCPNT ZYGRFWQYQDYKBFJELKIIOSJCHIKZSXIGMEHSKJXH FOTFYATRHXXCAGTGZWVAEDHWOBOVMTRYDFTIIEPD LQLWOYGVAVVAOUEDJGYNQWRMTJVMZDWVHTMTJCTU PHFXIWWYYKGZTKRXHZWXSKXPMHHRGTBTDOTEOSLD HQAIHNZLPOOBQQJIMAUAGTHSRZYOYTVPXWIBZLTW QLZVGAUDQDQFGTLCJZRFPAPBZDFSORMHTBDRYSXM JHOXWNSCDBWOKXQXCMONSDGWIIVNOLFPPUIMBAHW DOLEKNEJRFJHITYEISPHRWFNJRCBCSXKPIXRGDBJ WQSEQRCYFHFBILUVCQQQSGGLCNTHCPCCDFZEOFLC VFEBXVOTIRYINETVEPOIIZZUEINHFSCHLHSKMHIW IHFDXCEGXWQZZOPEGLMDBRNJKSNUHJHHNGGMABVZ YYDNGRLUTMQGKRXVPZJKRRSBABGUYKTVHMCVYRQJ HGMMGRMOBTLTMRFXWJXFVXQUZLZRDNNUARZOKIKF AJLVINJSSVRYUQNTXVIUQJFCBKLASFLXMDLFGGXJ ZVIFSSXIJBSPVQOKWOIYYAYYOQCINHQGARTJBBHQ XXQUJZBIVPIGLPGCXATBLYOKVRMTTWDWZTSWSWBG DWWACXBDUOIVNMQEGRLMAEKAQHBGWNFESHMOTBEP UBQDSYJQSKXCBARUBQGDLTZBNKKIKZDWFIQVWYHM LISFPBQLLEVJFYLOPAJLPXSYNMKVTSEXLORCSUOU WWQKZNJVNZCPDULEAUHSZITFINKHSYXZMCPINGOO YOTPCKKMJRGUPAGIMWVTFWGPROBKOOWDXKZDYHEO GBPXXKGHNVFMNINQSIOXJLHBATDIKHFZKTZVXXTT GXLDLIHQXSIHORKFTQOZWGDUEWDOJFNXKHHJMNFM MTPMNKGFGVSUXJNZJTVUONCNFIGUHSIAQUVTDAXQ IKIHCZLSXTFLKTHSDGIYVJKAZTEMQHHIKJSDLNPX YQPCFBWNFYFOFKGIWXJVLGXJTVIIFLOURRUNBVCK XNGINZGBVYJZTCLOBNINFALEXANATCGOOYPHZRSR RSNTIOGUYKTLGRGYJWRGAIJWDMIJRBODDBAHXYAE TEXMXGUSKHWRCBSVZHSWCLYRFEWYKCZZBACTFLBK SFPHGGRRTOQFBUTZLWXTLTJNJOYOIEBLMCTWCFWA CKOMIYYSWPPKVUGWJPLIHGPMRBVGJORRLKFTBBJX ZNYYGSVMMXPQETMRIBBIQJLYNXDPIUQKJHEIFIAE EHFUTHZKXABIMARHATFSFLSBKYJENCLNLAPEIDKP NWCSRNKDKGFUGUPZBBOKUUZPUEFMGZNLLCDJBBVG TQIHGETIZUETQJPOGEMJLZLHXCKCSAUVWDERVCRT AOZXMOZQVFJVWPHPPSDCAXSGUXDILDDJDKCFKKTX OTOBZJLQTAQTLDCIULOEWHRBHHDSJUWGKMOQVMQR AGSRFIHFMZMTGKWLOKKILPBRGQJVLVLMBIFHJPFF KLCHMZDCLNRKZYNGXHYHGLHIKGIZNIYRHOKJRHQW FHDDTBVCFYYNLVGATMEOMKWUDYVQQRGUEAXMAWXG TOMNLKCBTHTOYJJAXVNVPWXQCDQJYVPAPPALZVYK KKFPOGBTGTPEHQPGQGPICTAJEWTVRWPXDZXVLPWI JHUURGBMEITQWCYVINCM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      XUFSBPYRPGVQUJNFUNHLYOFFQNTYMFILMZBUUBIE MIBEWZGUXNYQTXYUKKKIVODMABIPQUYURJCKBYOV GRJBALKTLURHGUVAZYNTOKNUZJDQJADLTISAPIFB RXFCUWRBPEAEBPTSEHIYDJCOQGBGMBWDPTKCFUHW HHYQWGBXJGHRYCSHZYLEOBYKMYWLHQPBZOWBTPST CCOHHXXNYRXKIWIILGNWJGHOOPZBUQLXKRGGJCUB CCVQGDMPUHHQQAYDFVNLBTMVQGLMRLMMPLFQLHKR TBURWEVAQCDLONRXKXQPJICQNRESIRZPIULCRRGE WIBAOGWFILJCNZGBKIWFKQHLNPJNRTBYDSWWBIET RMFYKAVBNEICYRMXACBGTCEBOMCZELAASBLOMEDV ISLJDXXMDBSZFHSMHWOUUIXJGEAMRIJDBHRESHFI GQTMKSTBYWIMLGMETKBNQPJULZAFRMYWMDNLNBFW SAZYUGORQOHMRCFPCHMVDLOHNQIEDBYVIQXBXTJU UXEILAFSDDMIZMMTJUVOCJBSASEQCTCWOFLDMJKF JYMEUDXNJCTAYLRVOOOGZSKOAXVBCXGJCAKHADKH FLHHXSFOEWHTLVQEOMFVPOPBLPZDJUTBOPMTTJVC EOKSIJMQOTCGWHLKMTDUEPYNEGUBSGDDXHWGHLUF XVVIRQTVXAKAZSFNPXFKRIKAWGIHRMSPCFWPGJOS IDYZAVPDWTMCDMBPFUDYWIBJRQAPJDGIFDVAUNIL EGLHBIXLRSMXESQZHGCRVOHXCMJXUKSHFIFTHFKV CVJRKZPSEOJFNWOWARDJGOJRMVNWFDCCOSTSSDEX BSFTZTHBLSRUOKTAKUESELUEADCFBIGPDTVBHJXF HVPRNAYIUSVLAPBINNLKOOMNKKCIRXOYGHTJOWVU HZBQRMBNLOGENCPTRGPIAOWPNSTWOEFYRWGTBXQN RGEYPCYNTBSOBHQQMNYBPWUQYFCDVDGSAJAXKQEV YLVNSDNPFIHJVODTPKBNZTMZKYKTREPTMDIERVJA ZUMTBNSRFDGYTLRNDKRBDWSMAMYXBNAFYWIPCMOC WMEKGFWHQMBILGBIDNJZFJILTKQJVXUGJBNMFUPC EXGNOFHKAAVTTXZKHWOFRDOGFAEKENWHEYVHNRIF MWLWLPITPHEPXYEJBCMFGYECMABHMGNSUDQRSLRY FJSYYTMVNYAUSSQOJFIRPXRRGZJZLVXSUFIKUWHU TZCCVTXNXKYEIVBQBQGAPNBAXMUBZTJSXYICDPMU KQMYXUQVWSXZLDAMPVYKXABVDIFCLHTBRCLUPUAN TXRWAYSHBOXZAWSUEXYAAXBNQACRKKEEXOKOGJQP DFZCSIARTOITRETZUDKRVVAYTYIXKHYVEOYAODBP UBDRZSBFGQEXPLYVDKHUWTBHWSAFTSDNDPFVXYHY QDWYRMCCASZAPVQKALRWUSMBEBMUYEOVMFGGLYPG HLTVOMYUZHCLJOYBABFHKZVQHQWPCRMMQRUZJWPH KHKNHYGUGUPPONCQGNHCEKPGAIXCLROHZEPPRYDT XSRSTWPQIYUFFDLNNVLPVMIFZLPMIJGNRAKDKOKG CNTBUBLQBNEAZAFPEFCNPRQONUBKYGLSPAYEZREO UCPLUKXERETBIUVBXSRVJTWXQIPSJRLBMOBHAMZY HMVELZPYJRVJTCBCDEBISSEODLADDTGQHBIWGEFL NCQHPOAIKLNCVYYKYIKLORUJLGQDDAKUPIAOOCLY YXLSMFQOPNVKCFTASRYMNPHQOQZUFCEEIHBDNLTT CTOPQOXOZHQPJBYSEWHPHBDNOVKJEIQGUVAVZOHX QMLQMRTQMPKCHDOROUZDBECXFKFSKJFAYJJXMDCI NRXYDDRJDUPQPGMVZFIL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      CIKNHAAXVWBSTNSYDSHKBFTLOZGAIOGGZRKUOUOT SBJFXBMVXSADYJITFDOJRUYYGAMTBGWDBQUTVXFP MZHMGGUHMSZAFSCOYJASRNCFKYQMLRWYMKGUYKBJ EHRCQWUPMERHMKQMJWRFWABOPYFTLEXBKCKRAUQR VQXTHSKPDTYFAJQXSMLCFNOIYTQBMNYVWBNHHYTS BKQBUXCRWRZZAEAFDBDUGRDUJAQWHCSNZGQKYLVG GBTWPUWQFOKNMDOREJUUBOBCZKDVWPZVYAZLZNAX IPIWOAWKKSSYHQWXKAYALUNUOJYHOKKEGPRLPMSJ NUEWKJPWLCORKVNKLASZEEQWACHLCRFALRZJKJWO FGOHCNBXYPMGISLPQMQRFVFSINPXPLWOLSEMVZZM OFRSEPBRVXFVLEUMNAUTNTRMAIQKYGIDXDZIOYLK HMRHNPADOMSBZWYVYAPKBQBYKXWOCIZDDVLVKTBE AUPVECUEQQHAVVODOYLPXYQAQDMBUGZKJJJAQXRA DEADHVYFSLMTECEANVEVPDAJEEIPUFVCVMWLFWAQ OYVWETYHZXSTRVADYIDDINWUHYIHJTCVMJVGSINU XHHFJKNENOIVGUOGHZOSZINXAVWXCCXBDVKXKUOM RFYNJGZVVYWZIVJDFSYOSIZPNKGWNPEOJEMEYKDU WWOWQIOIQHUDLMPJXWUJTIMOXNTNMXOUBYNWLCSS NTPFIUHUYVHVUYBNIWIULHLVUTVNBRGMVBBDGNWU LDMLACKFZWKKGXURBFEDYOMNQYFWKZXNLZUACKVP RGPKOQJPZJQELZOWWTICXZUMDBYACCDCYXNTCWPX INOXAZBLSTSQXRHZMETFXBFBGWAXTGRHFYPSTCMV VCIQTJNNEUMZGHFBQDHIXASKCKYCKVAHAZGDKWQE RGAALLOHLBZHONOISKYODHBDFIKJZKYIVVABFTTF TUMBBLXDGRJZIKWNRKTRYTWXYPUXKDLCBSPWHAXE CYNUYHVDVHYRSGJAJQMHWQTFMDNJFMSGDIGRFOXY QCWBNKCAOPTGZIPQPCRAIAGUBYHDNCERWOBRVAOI EQWVDXGRICJFMJWWJYSMFNDUWICKMNOFGTNFCYTG EJOMQSURVJVGAFUWEVWWHDZLZWAJPJTKEQUNWITD APFHHWUATFURQNYRCZYVYFWSPARUQHNNVMMCVJKF MBMGITEHZHCTWCYRHZJPJVIHYKFRUZCWIAMVZCAE EHMLMDPEFNOCNMFPOIOYFXRNAGWJRKVFAXRAGJTU NHBDPIORSXANLFBMRCYSJFWYRWDZHYOUXMEVDMLW TZDEEYVSOKZUJZTFCLUARKJFEPYBKRTLAGNKSUOB YQRFHNILVWHZMHMGFYHIRURACPNAIVHOCVPXNGHC NQLDSUNQTNUCMPINYBOOFEOFSYWEAQMPGWPQIOED VPSFREHEUVSXOLYHBIUVTVXAKNFBXCOISJCJRSJV PIRYCOXZBCRHDTGMHSAVDIIHSPKSOGENVVSDTFVC PNVRJXBACGEFXHUXYULXZSSBRVCNBSNYYKSZNVSF NSIKYFGLRZHGGZCZXYXFWZKTJHQFNCCJVOQQQKAH JOQUWXYRPCJQXBHZCVTLFJCBNEYXZMKYPDVLVRAK BPTIAXDBPEYKKHMIPCVDLYOZGJUJIILIKTYPROBT EDKBQMQIDZVBIEHOXXUKQRKGPRWOWEXRIOQJNOAG GKESDNQZSHHXTOOQEDOBRIETVYYQUBRYVDGAWAFM KPAQXVJLZFKZIVTFFJYMXZDZLMWHCGONXIPARCPG EVQBENEASLQOZFUSQCVQHTDHZGTEQLUYBSHFFYOW HYDJGIFWGRADXVRDQLFMPJDWSVOASUTYXNEQGLKO KZQXUDZSKKYPLWWTHZGN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      VXRTLZUOWMPZWFKLWBUUTWDNGPGKJFSYRWBTTFOE BFGTHIYFBVGTZLDFLCQFBMCZBOQSSKFHGLOWALIR HFAFDPBSFBYXAPUKDPTZYQIQIUNQKPXLZFKHQMTM JCEAWZKASQJDOHISSVSUEBTUSJWKPDVSOMZUIUSN ZYVUKTPTXDISEQKZBPQFWMINQQPDETFLRAOSBRSG QUBLHRJXXSDPCCGNGYFCQZCVYBSAWXXDBHSJRCFR THRJCHGOFUSYVUHHAKAOAISAEOXLJBLIWXOUGMCM RVDGBRPFBCPXJWDJPBRQLCYWABZMQHBMZMLSGXOX DXDTLIWYRGTPJGUHXOQOLTGPNKWJLDPKHYWBAQSN SFGNTQGZPKCZKGIDHPSGDDLCITMNXSGIGBLBDARP WHIVPQHXTSLSKIEYNWURNWANSPUNTGAIXETAQJZP ODHGSWWCODEZVQMDQSKRMJTEVCDWCFJHDQBHVOEZ MXKFVTMMRXFACYZWGOWMCRZIJFCOPXHOWJRCKUUP HHJPXNEORLYWMWXUCYJXLFAIVSHTDBKBTDYETKXX EUGYHVWJVXLVYMIRUFEIOKZTXYVULKDYCBXXXEXD YXWOXQDLZTFLNKXUMOZMBGJVOPUJAWINFFDLFTEJ FCVPWJLWBIBXPBREPKMYAPIKQNMAHVQMNXRMMJVN KGTHQXDBPNNHEGDIJJWAOHDZPAFVPJUZCYRDWTHE DXFSHNBANOFCQVTZGTBFSQTNDCREJZQOEFXKWPCO MMXANGYJPKBENTJYJVLZDQANHEMQQFWNMHFPMHCJ GVILYALEKEGPKAKECSEAJJQYMKEPVWLFJTNZCOKD UFYVJXCJMCATSANZATKBALDXSUQSPCWIURSYCGNK DZABLKTWYISEMQXRRKUOHBKEIBIAMHXKSDQRGWUQ FFBARPCEWXKQJOKLENDWTPOJBUBTKFDBHFFWRCOA YVSPYTNFCVRIJEVMLKDTIDYMEBPKJPINRIPFUQQY GGEFKQVFBOWWKESDGCOIXYYWFFNPVVQRTMJZCRQN HZAVQWUDZRWGMURBMSPHQKCOOLIWDZCNRKLBJCNS AFYCHLQPBVYPFSACOTKDVJBNECCHTMJKBJBEDONN XWUTMBFSKGLZQSOTVTWIWAQJQHRYJHLLVXOBQDXK ZWRGHWXBRBOMFUORXBRMUCEGTRXKEBVKXQVVTNKT GTFLWPELTRQETEQGEWIKRWEEGAABXXSASKPARARJ YLIPMAQWWMVBREPCWLWARKAXINFFXIBKLIOERUOU RJYUMOWQQIETCOATAFZHLWYUERKGITZJHXHPLUDS UVHRSFDNGVDZRSAHINVJSJOCFOOBPOZUEMLUWLXQ KKDIYRHXOOGDAVXPZXTJXFZAQRXCRETAXTGBCFZM RNRDWJQSMTKWMWYFHDEEPWPYCHJQEXNZWSEGZDDV VPAQOPOXZZVCJYEKPPSDHAUYUCNBIJFEPCTGFJDA PJSQZTLKMNMNJXOIWWAGOQSVMIALNRIXZOULOZHA ZMTKUZBIALJKZXMYFWKXUIDXONPKKPFUKHGASJNA UQKGULDPWBQYBYBHPFKXJXBCQKMWPSRYJFIIFEDY YAMYVGCZTVRKJSQTCBYSZVNWKVHFDPHYNFRPUNRN TFNNRBBDOXDZHSNLPQEBADNGRYRYIJFXTNXNOYKC IAHCMYYUGKRKYXOZFLNXJIIZLBBTVCDJRTZOOHCN QKWPZJNGBQMKSBLLBUOAOZRNFQLWDFNYMXVEJQTQ KLTFMRRWXKXVCJIHPRQTIMXHOHYZODMZHIIWCCXC ICGJSBIJVGGNXNNROYVMXREXQJREUJOKXPTNFSWQ IGGBTCOOJAEJKKSYAOJRMDWMFNUVLHZSMYXHASMS PUXJATUEGWSGMIUGYUYX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TFFCEZBWSPNRJRFDAVLYFKPIFDLOZQVJNLKTKEEB RRBTLTOYTXBNAHHMZBMPIXAALNVOGBJHYJJCHUQA INBLPQBDZDFFYZVAUVEZWMSSYGEMPBAWQZUXULDR SDICTNLGWLJYYITARJJDKYKRNVUDKOVRMZYKFRRG GBTHBMIPXTYFSVMOIUPLZTUCLZLBRTVOZONRSLCQ XPZNCSQQXHGMHFMTNPUVWWQTOYCXSLAJGSGBFUSH BVLDMXQJFURKXFSUZYENHDAGLPTJCODKEFAHSAIB UJTHRFWQBMOPIIEQRATXNERULLTTNJFMPLHNJATS TMYHBCJYMFHWYXVGAGCNJFCJEZTYOIWYNLCYHFMJ LAKJMEMQZDXBULALLWVWXSTNBDNIWQRJHAXQXUIV QXNOOIRDCTTOGNTQWNUUBPANVACOGFMPWWVRFZKD FNYFWWCKVDXRGNVTFBTQWTDRQYGLIZUJSSQMEWQY GIIVEWDBFQEIVBOSEBZMCUUOPUFGBKJZPKZJCFME NLCYGODSLQTISCMTGGDDBJQGLYMGQCACGYXTGOPI IIWXOMBYGPBWTEKHMGIHGRJFVGDPIVLOQPXLZNFD DTIDEVJUMISSROSOAVOERMXBGPEJZHJEIXSBSJFE MPBYNNGHUGFAHETWQEMSEOJEBGKLZLQOCHWYKGTK XXOODQBSWMUOULDQPOCNWSWQADAUMPCKORZZVSIK KKUVJNQYUZOJTBIJBZCTSGXKXKDOXVEPYTHOTYUR JVYFGXZNFWILUSXIHUQTBVUXMOVYLZFZTHWHJJYB AKKEACWEGKJHMSAQTXMJKPDARPMREVIHJLYKLCKI LCWYXDLJLNLBHXKWMLJCMPGBZWTQNCWTGDPZBAPU MKXASRUEWHEDUEFBVHGSSLHDLEDFSHLZLJLSJONY NCNGIRZSBNTXJCIMTREGVUKWOKDYXCQITSBVPWYB RRYTBBFFTZDNRGAXIBGQMZWATYKMGKVUIYUMEMFB TIBCNMDNRVOAMDNXUJDTWHCWZXWFLTKUTGZSKWRC ESPJBILFVTBZVLHODGZEDDLHUGFPTBIVIXXCNCFB STLAZGFEWASHAWCELOHWXVFGOQHJGLVASEZDHHGZ ZHGMSVURSWBCGCEANMMNZYWYUTMSNPDIQGCMOMZQ QTVNQRCNWEYBQLMQFEAOZIRKTDOAYKGZIULFIIWV GQIITHYTGDVHGIQFKEHDALFAZKXGJMXMCTIKKAJU EZFSQCCJALSTCWJEKJRUPZLBHXRPXRJNDADFGQAP YGDODBPWEZUMROLZXGBPOFCKVYALWTOCGBGDVNQM VLPWDBDWFMMSDSUNPQOYLYYYHLCHFPQIQSDHAQAZ DTMTQCILTKSCKBNESJRMKEBAFNBWGQCWMUZGZMSG VNNBOYURNLHIWZKSNTKNHLUKTQLFBNQKEAMQTLIV ANSULCZMCPNGSOTIJQYVFPWMMYUFNYNUWQFFVYON WOOIOYFNHOAKWANFHCBCRDXRYAYDSZZEAQOEXWRO STPOTJVHWCKXTAVPVABOMMRUDXEXKRZGVHUPWWOC PFGLGYGTZLJVODWMMURHPENPEOWBJVPYDAPBXZNZ CARMBJLJZGMRJIUOZCGSAUPJHXDWWBSLUMYOZWVQ OYFOCOPOSHHWGXILKBVLVNSUKLNGRRVXRBXJMTRU DWNKCWPQDWPIJSGBRHFMHDPIDFNZWZZYYGZPVCHR HGEAEZAUFZPANQCCVYZVHSLKDSLBUUWZLYPKKUOM NAZAEMOZPRRSOWHNAQQDLOLERLJBDVDKFVHVEEVU SAFRWJRJGQFGKUDLWUKBEOFLILFBAHOESBWFFNFK PBUSPXZAZDNNKSPAPIMYAQVQRDTPVXIVQOGQDVFP GOLHUMAZRAVUSBVGIENX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      UCCGATHHXGFAMNTRTVLADPJWMUSBFDMDDLSDDPAD CNFPJJPJWFPHGQKPGYMDXUZGAILHBCHFGWRBFVWW LJWXYLHPTIWNHITSBJMJBEHXFEZGXJMNTEGVMUJS XFKASSMTSVLCCBGTXDXQNKEJRKMTXXYYXEBDDYRE UTENAFXHMNLKAZGYBDSESJUWMKTHSLZEZWJXCVPF MSQUYJLJVARVMTAYIXRLFEGJHSCQBPYCMEXJQGVL GRZBPRLEBAJTKGTXRDNRGSLUOPBRMZWVOGOPODZN WZGCQZCBAZHZDYVLPEJFBKMJXCDREZOCBRGBCNEX ZKDGOVXTKPNNTYPEUSCOBIEKTTOZLZHOSMGDWIWM HHJBFYULZCGHEFBXQSFJPLCRDHQWQJHPRZJECLKH DSWYBRROSLLBHLVRNVBPJOQYFENWVQXWNEONUTEO AHFNGEMUUPNFXDZKCACGWMPLSMSFSBERMCJCMESU DSVMGAFCXRRVSGXCHKCZJGEKHSZTCYLLXRIUHETQ LJIXGQRKTROVWQVWTHSCLUNROWLZKMTUWORDBPON JOMJMHXEBCLPZBYSHDZCEIBUHSCKEDRJHLLQPOUQ EJWMQMBCGXVMHFUIHWHYGYYVAUVBOUBYQHJFJNBW AKNAKMFKSLXOHFHOYLFMVDYDVHOZLRRQJMCENAZV DBQHUYTRIFATKIAZEMZHDGKAJICKSDFQWRLDQDTJ HPNJPECPYOTNHPIEWCGKJSEPBJGXJASMJMEZEFYA ZHVYZMKAEPWXLVDFYCVTHSHBXVMGRZBPJCLWKRPP MADTCLFOZTKZUUBXAGXDLMUCTKUNBRHZFQGFIOIV CKVYMHMBYNXVOTWOFQVEWVDGHGVCRHPDCBIAWGRJ FDWYJMPDGCERRRXHZFFDXTSYVQGPRGMPQHXKXQMI RXXRWITJEGCVIANFQCUAJBLUIPDOWMAIXTNKWNRH DYGBDNEXJUIYYWZXSRGRWQRJIDNTMSWDCJHTVNJQ RZUDUECINSGZUKVZFXJYOOHBHBBXHMIUOEWBOOGA TUBBFISFTZCPMGWCJTEEUMWYXNYXHDNXBFVTYTFA WWNIHHRPNGOTZWMBJNCPBFKJEJNFBETSVLMXDHCC FZIONQACYKERHUGGROXPQYTNEGLFAYOLJCQBOLIM FYYUUKAAGWUMAJQXVXCZHPTRQHBDFVHHCRRBYNNW SDCUEBBGIHSZZCILTPEOHGGIVUGBBWFOPMVMMDGI HKQLGJTPZSTOBFHMZLGIFINGHJXSEZMALZVGUWFX YNUAKOYVGYHVNFHTRBJAHSEBRZXRHQIEXIGBBUYP DHWOSCJSLQKEQWIMVVKDUGVOUIMLMFPYTGREDBSU AJHBGHAKGNDRMYMMIASMJMFZIEJRBZQMRFYINTYR HLEHNCIRHXFSKDBKHIRKRUQJLXXOGAMIQJKVDSUF KTOMGYMVKOCYPYYQRELPEOJWOHLSEXDFZONDUSKS TYNMANMGSLGAADRCCOJPLSFFXVJSURASAAPHFWOM HYJCUCEQFVGQLRVGDNRQGBPFOWQCIYWIPYILTTFG BNZQYRPXKDYYBKARBCMQQTRTWGXUTNFRWRYNVVPE CFBDWAQJHRTOFYAFBSDBFNOKDDSLLKNCZHYPQXVD TXMMOYPJAJXOSRPBPVFEBHJXDKYTXHWZFLWJOQRB QELRMEYYZZFJRRIRYEPUBXQKJCAGOSCJMPAUHHGV TGQNUTDQIDBLOMWJKPRYEQXPHGYXQQCHTWDMUHUF YOTIMGDKCMDCYZCBIJMBVYZBWPIRUIELHQOPQLJI AONWCYGZKQAWOYMTATGTQDYAKRHUAAKCUEGKHUKQ WZNRORHFHITCDEZMKJSRRJAMAIEHIFNAMGUCRTHP MFHOKAGPVNKPARZHGVUX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NTGQDRFSSRDXRNWOPCMPBLJQITCTQIJIUPAVTUOJ YGKRTHUNUZOXQSDXSMVKYBSRLNDNOCKTSZUVSXBC YWRMDXWDJZHVRTGNUGOOBZOZPTVERCTVERAXWNHB IFOTZFBZMLFNEBFPKYQJYEIMSKYWVSPTRRHNNCZH KJZKOTLZBGQEXDBJKESVGORUDHXJOLSDDZYGJTVG QGJRGJAMTBQZZGOVTRDONBDPYSBOPFXOHNGHBIRH QMFGVQSYQNVVGDVTXZAQXMZRJURPVRQWGLAIMDNO UKYMUKEKDVIBXUSPNFMFTDZEYUYRFAQWXBPSUNTU FOMWDPRIKEAXUVXSPVYCQSVTELQSGMPYBAHPWBBT PJQZJESYUERBPGAOQUJMJPAPIYODHAIQXXVMBQQK APKVCUBUDZATLWLJCMEROOJRVRJKJRAJRYOGDSKG CTJYANOBNFLFDKRRPUXNMAACGMOWOASGKYCLTLRN UDVUBWIALZOWLVBNAJEJKMGYJOHTNFHFEYMBCXEG RCEXCXDCKZTNXFCZSAVYFXYVNIKVHXVJZQNQMKWD KURVLKUJKNBEPZKWIZDLXZSTUXRXYJKXRQCXSXYQ WALHGDNTILVORUJNPIOVUMUEAMXIIKBUINVFYAMX WLUNQLGQTDCIXSZZDYRTHLUGJSIMIZNGOGIQTKWL HYMNJPXFULEPCIXZVXACDJVYDEFFLQPDJIZHMGVK OKUPFTPIQIGMZKKCMOQUEJVSWAJKRLVLKUTEQCME XTRFDMOTKUZILBYNUJTFEQTVMTOKECPUUHMKSRBB IVNEMESLCFKFLTQWVPVJOIEJRVFGZLNHSUXWVGJI FGCQKUEXQYAPFQBKUZSLDJUEETJIANAXNPRFGWMX IMODBQJVMQHMEIFZDPUBXMBCMADUSXKGQZKLDVQF VTYEOASPPGSSHZUCGFESIVLYAGHNNUVJILRPPJPE AWBCAWPHEYOKEKDIOSTLYTMZCCPIFSQXLZILSCBR AZNFOOKWEWIBGUYFAHRXBQPYWWXJSRESBEBDPPRK EHNLZFZWOBLKSIPCHVMJKTWORSXKOENGRFYZGWGE QJEQMDSYYVNWOITOMFDTRYWZAZJCMNNLJQGEDHUZ YUMOEFKRUMTZPKKZRXOALBFSMQNBZBRYURMUJVGH AWBPGPIYYTANFURLFQNPJINUOAKKSUKNCSHGQEDN UTYNQOIOYYSXHGIJWABPPAJVOMOIVJPVNPWPNEJB YPPAFKELMDHURFNWZNOMNSXAWPUFOLNTQZJLWLUX AJJYJUVKFNNKUCRJFMXZCLXUCZRVOWKDPICTMBCF WFYGODZTOEQRWDODXYQCUPNNGMEIDFBKYLNMFGUE HYEMYYOFOYBIHAVMNWXFUFCTIYFGAGKIYLHJOJHN ZVNCFKGOSVUBAKBINBLDILHTYYVTOFZQBMHDSMQT SRPBCMPWTPVBCPWPKNDRZTUJVZMPXDMODYLVUVWR JTLSVBIDMBTCACIVQGECHLDJIKTNBFPJOZXXKJEO HNLDLNEFCUVLZMBLVALGQIMIVQHEGARBPDUSKPFX WASGIIZZUKYIHKBXTYXRAAHBBGRARFOATKIDQHWI ETDHNLAJBVUFYXRMGOAMUIDQQPBJBHMGHQOOZMYI YQCAXHYBVKUKODXFVYATMSONNQLSIWPAFSPHCJCB ZRSEBZFBEZQJHYPUXPQPPCMMZFFELDUVMKCQXXGE ZZWQBLLZMISFAJZPRCFKTFJDMKHNFQFFDOXWSFYA DMRHFVQJIWCYSMXJMPYRTTFXLUKRXPNQOBGILAHY LJYDRYZQEDXKHZGGGYHYCMDKNYRWCLTLOPEJYPEH WDPUMDYSDAXKZGLMTRVAVADFURRXGHKNSCOCTDXB CDVWZTGJVUSGWYEYMUKM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YTFCYDDHZEUMJDAXXGQTBWHSNBRWVOFRWJDSUTTA CFTOOXXDZTQYMJMGZKOZKVAQDCMRCMWGFFYAHDEU ZRLGMSVJREUICBUAFFPNFKCWKOACHCMQHRHHGPKG RWAZCHIOAKCNJHSRLYLKOKNEWVJVEUOVBFWFGZVE UXGPHHUNDKKSPASSTSBJBXSAUPOSBGCHDGMUZRYC NEOFBLDOPKBGITRSJVOQRFMIMWWFRFCXKOSJSLTT GCURWVIMBHDPBWTGKPPWONHTXILSPIYPHSQCDDFI VNVTTJBJGZUPVAGWWFWCEPAEBOWAASSJJEBHUSHW BBPZHNZDIDWABOCHSVKOSKFOTIXVUYNVDBUCBZQB ASMOICKYQHWEVRCUOXIVADLZNMFJOITXRMWLMWXJ BACQDNINXEVRDJCLLOQBLXJATHERBTHEEYTEJDSH OFYKURYCHGNQRJUTDQOHDGFMXWOSJJMUUUQKZPKA VMWWQZMTOIMSAMDIOUVTEHALVBEXLIJHQNVKEHGX CAQWLVTNXGYETINUYXHJFUDJHVBKQMRFZHDTYWVN ADQROTJEKHDTFECXSNCKQKRDWPHCHZXECSGURFRJ LYMLZHNVEFMZTFCLLWNPZNKYHCGNVJLFRVYKUOKH UVEJHLXRHQUSWYEEVEDJNZEANIZOMZPVZAKSQQMS JVSJLLCAVNRTWYDWFKYTDXJABIMGSHBDHUWGTMNS UYFYFDAESSKOVMBECCPOCOBGYLVEEWLJLLAVJNVO MDTQYTJQUVDAOVWBDZEJGCQGSHPVUNGBACUZORAG CRCSDSRFTRQZLBHGPNUUHNMPLZAYIFVLCVTJPHJS ETYYCIYROSIFSRKSOGIBXHPLYXEDXEHHCARUHYWL JBYRHWOGHHGEPCKBNHWDKSACKNIEFGWAAAWEZECL FVIKFYRXIFJGIMMMVKVTVRAKJLSCVQRMVDIOOJYS KYYDJZNDEZJKAMZGASDHQVKEGBRGRISZQWGAUOVE QEAQRSJJAVPEIIDEYTSRVHYEVVSVUZNTYSCEYICA PERDAGZMWMFGEJYQBPYOKSESTEYIBATPDMEVGLNP GJJFUQCWMCQRJMLIHNLREECGJFPZKWWBQPXTGPCQ WMSJMMDNLGFAZELKCCWKASORPTSCAENGYIQOORPL QFOPDSWZLZVOINUCYOFXSYXWCAFSNMXDTGOSHAOW MHRMQKDBXFBERLDIUHAENNFHIDSNVGKQKNZXELPF RGIAVENKMJMXZYDTVVHQCMDFKADENRUMORAVGCDC LPMKSONFJJSHDWWFFBAPTRXFICBCMYWJPAPKURPF NERPUFKVZYZLSRFQBBXANMMRSDWGEKJHNXEAKDKB YLAQSFSYPLUWTPNYCUXJLJRWAXCXPYOOCSWCFOCS XDYXKRGJQZKSZJRVKQRFPIETPICVBNQXGAPPDXGY QBVIVAVKSHTVGXHRXNCQTKOAERYJNMPYMFIUQPOW XPZXNVQPGDOCFWXRLTGSOIDIFIJOMGZCARHRGFOV SLMDRZCTFUDNMZNBFXSBLKKVFAVSVQRXQHAIBRXK SQFZJEKNLOFAEOOYVCYLZWTOUFYXXSEHZXIDWWHL OSJNLXRVBWOMRMYOEZNJTAIYJGSLDZODVJILWRGL CVZQPDGHRYNORPQAEYVJVORGAQHQZAOBTBZZIOTW FPNYYAZBVDWNYLZTFKRVDXNOTLJRZKBALFYNKPYL VPEFZQEZJHWMLQRMWAEJLUTFMGKFFZFYDAPAVKWV IXUWYBIRMQBVUXYBJXUEMEIVFFVVYTNXSCCLQAHF GQRTKQOEBPIKXRKKZNAWSFOBIHGEUFMBMKTDZFJR QTZHAFSKCMLJNHSIVDCRDNHBJOCMCSAKRHBUYGMA DFLCLNRTKPSXEWUDRLXC
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      DBBDXOUGBDQDWXFXINKSFCDTUHZWERUZCKDZFHYI MPDCVFLUBQKRLGHOKJCITSVPSBWTOKBNJOVHAPFV YPLSXPBVOGFBVTUXBNNARJZHZDMYPUJERVWWIPQB QVDTCFGYCXFSATDDLAGXOGSXVJJSPJATGEABVYXU KSGIXGRJIFDBJAZHGRXBJSZWWEJDQCEDQUZMNMUC EJQBXYZEMLSOIHRGWUOXYMUOUNBXVMXNQURLVCTG DSPUBUNFDTONXNZWELGMUVPVAUBLXRTBCXKPZAON XOMFDPYXBFJQBOLVYXYUZAXPQGEVVVXOKOGJJEKP ZCRTDFVRNWMLXIOHKEDSXUYISTFIYDUMEFFJONWD HUKPVSTAEBXJCIHETDGBHDQTCZLVNZIBZDACJTSK JIGASILGYFMWTOXSNQGNMEDLBRYWAKRRYYDJOVIS EZWQTRGNIGTSGGHINXSQXVQBYCTLHMRESNVPBXXR ONLUVBWKQXMDEUPDXJZUQGGDCKAEYZCEWXSHDDEN CUIVRTULLGWUFFJWBRPRXUDONYJASXPHQYAPEPYH RSOICXYBQOGKIXYCSPYEPGDHKDGZSGYQLPKOFKEP PCXUHPHPTBCWETPMOOKBJRFHIBEDEUDGODDUUGFO LQLFAFJMRKGLUDAXJAGLNBVQAWQLPMUKZMFEURPK MRDKZMPJBQIKFKAVUDGAVUTVLFGUUQUVUSJWVWWU RHTQFYLRMQQQWJGNIMHWIVNACONKZBZUZGYAFQJC BDTQYVOXONEUUMOIKWZAUHFDIAHVBJKFODRWAFWM QWUTLPODCRIVWQTIUCGMKGQTADFHYTUZDXQCMZUU GXNGRIWPBJXXRZDBTMSLRFRBOFNCOHRJDKYDBDCZ FRVLWCXDKHQAIQRTQCOAZOFUWSXFTOABJHSMDHKP QHHFIRFRQRUTQOLZLXYRQUSIUVLOZGQVYUWKTSHH MTNUSEVSWMKTOWRECHZVKDZGVCFOHBZTRZYUIIMM QZELWULVSDKPKNELBRBGTZCFVYCNYAMKCKOVCNLR WACEBPEGAKKJBAGAPBMQBBJEKWOPFAZWOLSWKBLL MZORBPJKDMNFHGYCWKRFZYRIEGNTMWCMOFBNMNHQ NZQRCLCHXRYHYSMAGBDCKGIQENOYOXPNIZOUPOGS DATYNOOSNSCINIBSJJEZXFBSMHRXMKYAYBAQNSDY CQHLBMDQGTYCWECNFHLDUJSASUEIRMFOKUUNRIHD NOCOKLQHJBQFFIVEUGOZPKLXZTGIRJYXTDDLHGOW ELLGSVEAMKBYQDJJALGCNAHLYMVYZPGHUPBKZZJG JXGAKWNYTWIASGMAUSEMXLJQZPSJMIDKVRIZRDQX KKUTASCKKQGBFWEOSPKWEYOLTVDUQLJFZHFIHZUS CJAVMIOJIEWYMYCDTSZUIMMLEQZIFBPRZKMWFSVM SODXXCURMJRFDSFCODLPURUXUXTQDCUOSDGBJNMG OZZFOJMVYUYOFOWMXRLFNBSTVTHAMYDNHCIRHMNU XCEQKTDGCWYGQTLQGBDNCURZGDEWQOASMIBPLHNW IJUJSYQXYMKSUYJMZBONTQEHMWKVMWIJZHYDCGNF HAPCSAFXWBAZZJXBSQQIRWKHTOFBFFMYEKKRJOQE RZYFLGWIYRZZQNADDGSWBUCFKAJEPTUTKVPBDIVZ RWQGFGLBUBTMOXSDWIQLLRSBSSEQDXHIXLVRDGUL ACPTWIQWQGNPLEIKWHNIIEQYNUGFLAEJQIIZEHUK ZFKARIZXWYUGSBPBJSLAUSYHMODZLBPPRJSEFNSV YABTJXIHITBFCDBPRBFWGQTKLLBFHCJPDGSHIJYW XIQVFIRZVDHBGPEMTQWTGARJCKIUUCXPQVNKDQWK HJPFXPCDHUNUUUHJZCCC
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HKVMFSYGWISIKTYULVCGRYPFZOAADAZUJMBYNZRI HAOCOSVUWYIGJVZSBNCQPFACAIVXEIZFWMIDSWHA GBSXVGFSYFZTCTKIQGLQYALQJHXYQSHRITBUMCDQ YFBDOBTACLGRFGUIPBMXODDGHCEFDRFKIRNJVABG ZHGJBFWBVSKZHGGSWUXTHSMGIJAWIYMURWYKOHBD ULNZSQDQVODNBRQYQKHIZOPAJZMSBGLWQDLOTXVL DCJBTQTSAKZFNMVUZDPNMHJVSULNLIGCPBCHREIN BWTUJMBLSLABECVBLFKCGIDWQYOWSJNWYDMRBVTV HJIVPEKTIFGAALJUIWCLXVPMFTXBMJUKWPOQLNOX YMYYRUYCEEHKBETHPKOFTGATBGSIYRQVQBYXLGEX BTINSCJLZCXIAMFSMKMPRGMMRHYQBYWVDNRNMRXF NRFOUUNQORYXBSWCZNEEGPPRRNTGOOOTPBWWBTEJ VWOHYFSIXSTVYYXFYUFPJYOVIYUYSDURZQQZDIPP ZOUDJLSFCQAQOVSAUZOXSVYOZHVLEABFQFTCTNUE BQTVRNNSSEBWITBKJGNMHXYKGHQJJLUBXVXTPDRX VSETISKLYDJZLABJDFPLCKZFVJRGVRNSFTQRXKXY RXSLGZYCRRPAIWVPFIAPWWCIETVJEKVLCZQTXGEP ZAWUPALDTVOZRNUSAWDFOTQCPQDCIRVHLIXCWYBD YZDTLNMQBOKTDOEFLSYWAEEPVSXBOPGFJEVRJKJU RAXXXTOUSGBINMABBQMDBSABOOLVRGRSLKKHFDGW PQESRSPKODSMHSGJCMSRNHZEXIAQRBYWJZAPXNXS FNRJWDFPTAGOLZEVRHPXQKBJMVZPUKPBFJRGRKRZ FZLSEIUUIEWKRPSVOKOYSPSMMHKGJCSGRVJVSEMO FCVOHIPIRWKOYTHQTKVEEUXEDVRPZJYPUBLDYIMI QZCRCTJXJZQVGRKYXFQSURFAETDGYRDLTMQEBETD PPJASRQBWPDKENZJPXDIRTULMHSPBKDVHTQOSDTN EKNVFOIJKDIWKHCYLKVAXGNRWRHZTVPOMCVNATCJ ROMSFHTBZHYHFVMPPFVYXZAWUZDOADFZZHIELMAY TVYCGGRHLUNTQAUTGLAEKMMLDXYHDYMOTILKMFUM PEXABWIBUIFKCYUSXYBKKFGZEIENRBFISAWNCQFQ PPBNANHZSHSVUMLCMAEEMWNTKHBYACDBMPALJSJV ZFMEZDKRVCNNCXXEAMPNFPEKLXDTKLVIBZMXMPVN ENOTNPPVFCXPACGMOBCHMUSXBQGWKDCPJDFFESHF TAIXROQILOXOYOZBENTDBJTCSVCJXBURQVBGHVZB JAPBFAXRWIAFPINIXXIFNBSGQQRSQMYJZQEYHOTK BFBZQZENANUXEVLXNDURHFRGFAJNVZAVWOEUWMWC ZVCDGEPPHCLJXWVDZVAAHTVYBGHLINCSUWDHNKGA CWSQWSKNZVVQFTDESNBFMKJZLDAIQOOKSKCXOSGW TZGHQKARJTBAYOZRHQJMCGFKFGKGYUOOWPPNRTVS DTQOAUDVLWLAYSOCMRVAYUNFYJQKTZZBFEIJSTAX GRGGOPMCSNARNNDKEUPYYVORCOEWSSGNHCQBKLIV HFRUFGGXTTMYYVWBIIGFCFQCHXGTMBYFZKWRXTZC GNLPRVZDDUQKYCQKAZIJUXBVVLFCOFKEREPFXTTZ HWFLMVUPNWVSNTXSKEHBSIWFXNRFTHDCZWHNZFIF UASAFYHVNREYEFEKEADWWBIOJZWFSWLJXWARSCWE LNOYKAJHQFOKFSJNFLEMUEZZCFMIOPZDHXEINTJH VLARLHAHIZIMYMWUZTUCCJGAGMAODGYRBVWXWQYF JHSWJRSCPLQLFHJXQSFE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      VDMHPYKJRUEBQBQWEWDXKKGJPJAYEEKTXPDGKBBL CNCVDMYYIRIOVECXKVPCZSRWTZVVFEKETXKGOPGX MKYSQSYRGHLTUNQEDFBQFAYCXATYZCRIHBXDUSPR YFMTYHMHASBGWHUGVMBVEFRHEYFLCEUFOFBOBBRA BQIJEWFLPQMCFTJHILCFNTWJRQKDTJAHTLEBTVAG WNJRAUVVLOJWPXSLUZYMJMVYVXJHEZONLZNFXQCA JJDGOHEAJSINWUIRQATHQURSTYZXVIRJPSHMWCFA XFBISUJKUWOGWUUKANGSFSEKFAMPKPFBTDWXSBJF ESJTCMPSJYVZKSTGQZKIBLIDOYNNVZMWEBDJSIOJ OIZTLDTLGVCCJMXNIHKLJUMROWJEONOODGIKTVXK IBLOMFAGTYXUQOGLKTDTKVCHJLONQRVXVOMURAQY ATUMTILFFLPVTLWIFRWQXMALOQFSPAPZEHSJGZSD WROTWKHHMJADZEEHDZRVQZCRLKXVWFEKRKCBLPFK OMORKNBYLFGTHRAIVBWEDDXEBKZCGBWCKUBLGDYA KYLPTUGRDMQBGKFXDAJJDMZGKQERKYUBKSZOWTCW DPKPHMMYYDDPJVBRYBLTEVOOVWMIWLBSMMVRKHWY ZLZNIGBWKWRNHQTWZWGSHXGJYLGALIMDWYSHYKCX AECGUKAJHBDUPQLAQODZBUWICHMDSKEMNSAYZYOX XQZFKAJTQTCINIFOXCRXDUVXSODAUVZKUJXIFVFX HOBQZWDVHFMJOOPOEYCZCEHHBOKDPFAIBGQDGVJU ZCGOVEPJIMNDNGMNTNQWMVTMECLASKIWUYYDUDWT DYHEFYACBVZGTOJCCDXSXJZJWDCJSYJDQGHHSXFR BOAQPQYAVICXBTFHUJDEBJBTURCQFHJCWTBOKOAR UWUSWLEDBEBLOKSDENFFUVYKXVKENOSAUQYPWSTO FGMKJJULWQAPDQQYMMODLYVAEEZPZZWIKOFTYZTO AMGIVKGMXJZWDQQVJYKQRMDHLKPVNWYTJCBAUHLQ PVEMJFBZAEPQXVKNRLAXCCRRGSAPZAWCFEQJLPHQ LXYHCHIQAENSTTZVGVAJPBPMOYHTEXZJVVHJAFKC UEWBQRRXOULISBUCFXILYVXMXARSMBBONLQFGMQX KBCIZNKZVZQHLKSJAUUBWDUJWTNRLMCYRZOPUDAV QBTPCNGHNCRBTKCVKNSMMCAVDNJPBKVCYXISIUNW VMNCOKZVSAXZRXGWKLGTQCVVMSHXPBEMCGNXDMZZ RCVGEXIOTTVNDGMZMFNLHZOKWNUKXHMTOBAKMZVP QHAAZDFINKEYXTUHQUZSAUZYAQKPXHBKNIHNBUKI LFIVRELCDHWDRGMYLXONRAIKZTFVDPWCPGJPBWPY PBNDPLGGRTNUIZDZGZZGSFJCFZIIHJIZMORQMHIS AZFTUFSEAYHMGVXQQVGXZHBUXDSIZUZSGKFSEVYU HVEIIIVEWKPYSFOMBRUWQNMKHJBCALZZTXUZNZQW PWDTUDPKBHTHGKAOFOGUOVIDVAEILAQIWROZFJMY NETSSOVRXJVGDUPVGRXIRHQGGNGPNMAQENBZSDXY BNQSNRVZANXBRMZSOYZUFVGUNPEONROXFGUMUUJU BBSPJTBMPIQYWZIRQFJDUIEWOQSFXSMUNRRMDFZW ZMOASZODERZONVUKBAMXWPIMHBMUEJXAJAWVAPJK KGIOEENETOOSSZCBEZRIAJDAWBEJFHOHLHOBMJHS CQTWAUZJSJSBKUDFGTLSABRSLHFNAGYKRTEBDMFV LMLNRXZBLSNGIOFJLFUIDMWXCDNHFHUOQVIFSCJF HQZIICKXFJUVJEXJDKWBHWHFBMPGIBEVCKMDCUMF ZHDORVAYDVNRIVOAJHDL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WILGYUSLODEQNJPLJFNRHIHQBJFTSKIVTZUWUKGL PLIMSOAFMDPESDATGONDTMYESSVBXOCLYUGQNWHP WUDZCLXUGRPOYXKOJHRPATEUNYLFTPUEUPCBCZUW NMXMGGVPRQGDDKPHHUCBDQBGTYHCOIRZSPQOQYRC NAUKGBBIILXPJCTYGHSQUGGNNQFKQQXYMXTTVGAA NHBTKYUTFBQABXDUMMRRFHVBJJRZLRBYHSRCTOZB JGDTHCTLTZKRPCCZLTIUJWIGEYYMUUABEHBVCANW WZBYZQTXGWQPFXEIPEOANPPGPMFQUHTYXRQIRUOR OQLXIGNAGYYVLNTWYZREEONBQOYGCMAABFBDCJZK VIQVIEWUVDBOBKTDVELNRMLTTPORLCLRCBNCCLYU OIWLUIAZYGVGMCCJPWJLWHVNOXEDKAPOJYPSBLNZ CFAAKLSVFNBQMEDBIOVQMEUUKBIZWPTUZCSIFDTX FKLNHCRCQCKLDVGKCVYKBMSVVSQAJCDZFCRDREUP UIEEOZZNLYDLBQBWVUAGVSTXJQGEKGAOVTUYVJHI OASJUUZVMXDHBHVBINKGBBFGTFFLSKCQNMYTBFTP RVJWRAEXDEAMURORODVRUOKDFXSTTCWMTYUPBCOZ KDUAWOOVBYIAEYMZMTHAXGJFBJWILPUHTRRNVVUQ ODKBSQTZMRLEDRCXXPBQGJAOSWNDGVOXMAWGDEEV LXBTFLPHIQPBJAFCHWKPBNWSPKCSXMSYJAVHDSHE QOHYCKVNEOZJFUYRAGLZMAFBJLZSVNVESTYUTAOL RNJUOXDLWYQGYAKFJRLRYDQLWJWVTSICNHJQIPKI CFPXWDHWBTPAJAJBSTCHJTRKZVHRYTCHWFATENLI WAHXLZUCBYHLNXEWGZVBYWQIUZLVFFSWIVUOXMMU WOCECYBZHNNUEQCNXBGSSNOAJQPVNTULJRARZLNB BDXSKYQUGCHHFOPZYIMIMVBCIMGGSKBWSLUGSSKV UOXDRYAYXQBMYCKATXYYRYDPOSZALBZYFKTXCCSL JVOSICJGJZVWGZJYGNHAQLUWLDTDTFTHZYNCQQSN APJCQSMEEZSQRVDDUDRDKBPRDWXLWLSZVOQIFLIH YSCGEHQPCWEILNEJHRRRAYCKWHDQABURDEDGWSVZ PUMHOGKQIVYGNLTUFEBYCIHAZYSWHWCYCLXIIUDR RMONYYAOSAQHNINSJWRHGJNZTVMVALXAHOWRFOMK PDDEOJLEMXDWSEGEDXOJBRDBKRSRLZUDGDWDPEYH WLEBHFMVCHKYJXQGALOBJKBTXIMKSSWITPCGIRQX OGBHUXRNIUTNEPMFRTCITZVDJTRDCFHPLGBLPKXU BIFLIIVDDWQLXLKJVUIRGUGWGYMQWAUHUWEWYRVB BWBTQKABLLJEPYFMQECWKUOFVBXWJXPJRQKGMEBQ WXGOXNXDNTAXJRPGFXNQPCIRMTTJJTUAPPRILCXW VHILCBCOANQNCTSNRITJNDGEXJCGZTEGDSKSSNBW QCZRURESAVRXKCZNGTFJTAWKTGKCZOZFXTRCVAUK LWUYWBRIERPNXSPZLBUCGGEHCVFJENGSAPPBVTMF SHWZYOXETCFDMKHMDEXHBUURQUFJJIAYQIAJVICC RJDPDZJESCNFLVQBPHQYKALUOQFCDQLKPNPNYSZF VFKQDOGGPGDCJCZRXLEEVEXVGELKMFVBEQQSDQKD HXGHERDEREVWJWFUQBENKOQXVQDRMTFGAIOBQNML EGAANPGBUNOLKZKZNSADVNTIOKDMWIPKLEQZBCMS EOWGFZWCUHTOXECGJODPWREMKSPUYHRLXLFYXXGA UXZZXAMSNXQTKQPPQZUZENYSJLDYHHDRFJIOPMKK VFZJROULHDJDRFTPYEJI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      XZUOPPQYROQSIKJTBVMWNFVNZTZTAUFQOEMGNXHY ERAWGJQXLAFVRXVREKNIWUKBTWFBUGLNWMXLCFRV FCKOMZFUGPAWDFUYAERSCYTWPJSNSVECNUWBTDMX XHDVIYFHLGZLQOODAQFWVKUXEGAZYWFGKFRUBGEU QKGYWFFASZRWLZIHILLJSWZGYLCAAROGOVUYYJIC UGCBCWGNFPZMUDWRHJJSRXNAKICIUZIFFBTDFRKK NYVRDHLRUGQNFCEDLMSCJXUHOKWQUSMQPKPBJMNA EWIPFBADOWUEZCFQZMJDEVHZBCJDPSBZELOHONHJ UIVGUHDGRQZCNHKYPPKGRLHMYCKCHZEEISDSLNOH RMKDALPGTMHLWTDOWFYLLCCHZPGYAWFHYKCLYSJG JGWWCIYDPRVNKSOUWZHDFKPTOVINPCAXXQAOCMIY XWATGGYCXKBIJQTMODYLJPTQTFYONGFMPGQLDAJS YSRVDCCZWBSVWASEVMPOKFRTNVVEOHAYLWMTTDTE FCMLGYWDKPVYLDNSABCBILJWNSNGLRKXZIIMUJSF HSVHKMSQZSYKEAJGVRANDNWJIPCQRMFKFWUDWXNR URTWSKILKMNTAZNEFYPJLUULLGBRNPFBUQDCPJHE VUDFGHXLZVNNHHEKSLVEQUOHFWDTQMGUZMQHPEKT VPTTNQCUSRFUERZFLQSDONGMOCDPIDEFTZXRQXGD LLOSJEMBSFJVALGABFAQABRDRJXRZTJYMVMYGSTO XCPSVXJJXNCJFDTTTZMLVBFGNGMRSMACVYICGUGW WZLZSZSFYZOSFMIMPSXDQJBRUFLJWHHVYZFPLOYM OOAFFUMBYLEHAVKTAEKUHQESBZTZAUWVJXAUURTG AATXSDQOMXVEBETRVCLNNKSJIFCPNOJPXVKLSAAL MBCIWTBFFRSBNUPAJDUDZQIMXPNSXIDLXZTULVLM XPARLZVFIQRIQVPBHOHVSFVMFBWPKCTFJTZPAFRZ ZRQMEGRHSPLWZXMVRRQLXSALLBPWFQMWVDDWXKRQ WNDKCKKRPDTFDHUGYKFJLCHULDMYFHAUXJHLTWDI VBXZJTKXTWLDXZPCJZKUVSYTXNPLQAFFUNUGVGZO KPGJLYELPGQJCEDTIBFBTEGZISIAULJZWTPMEQCV EZEDZCDDUPRAYIIFKRFXBEWJLNYRBEYQTDUCAYGQ AFPJTVNAWEHUPVZBVUDDRYNPOIBATRIRGROREZTB ZWHSLGRHUPUSCAEICLSVQNMDUGRXPVKNDDZMBUJC KTZDXTNWUALAGQRHPIIYECPMNSKXEDVNBVDPFFUI BWTKTFOIWJEPEHLSDTPHHKAMPGEEHSMKNTWOHLDJ PNWACEJZPCTYJHLNNYDLYHIZQPFZRPNSQJPZPPWF RIASHPZRSAVFIVFARFVVULZWZITFJYPAFBWUBSGA HNUSQNZZVRFQDBRRZFZCXMXWVRVVVNIKWNGDZTGJ NMTFCQPBUAPGREBGXOEZBBOCKCYMFVMMTBTKMNJZ ZMZJBAAQQTKVZEJADKBTMDHYWDCDAXYMAQIDJIQQ JQASCLRBTPKYTYWDTCQJFBWLAEQNUMCRPBZFOBRX LOLEPWBZBCLWEGMJDOCOXGDEUOKXEDRKPRCXRIJT QGDWKKDBZIFMHKKLCUBJUXUEZDTELAFSZLOEECLR ESADZQRKMWTBEKLHHDBKDJBPVNZNPIOQLCVQCBJN KLUCABSFTVCBAUJWRLXFKSHUHOFCHAXFCPKPBYZP ZMVBGRHLEJSTWVOGJGXNPKLMPIGPIMWWKHOYIDFB NADAMEEKRENIRIEUUEPCBEDJHYFGOVRFOMJJZPRB GJQQANIIFHWOELXXMNOPNNNVBWCDAICPQMTIMDPX RTQJDCEIDWLQHBSDVFOG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      AVHSYGOOQAEVEIQOQFRAEFOZBYZHMAWGTYGEXBPC QYCNCQUCXZMRTFBAIISZRASWBYRBCJXLDAWRHNNK GNISRVEZBYWGDLCGNGNQTRFTYXTXZTKIOKKKDWZE MDLYKOGLVHQIDICKCWHBRGBOSBEFEPDHKQYNWBHZ DWREICAQLRQAWQJPQISUEYKOTYRPKEFLOMCQISGS XCUCPXCXBYPXIKUZMFTDPMPTEWJGRQFCOEEKBUGJ LJPPQAIHBSCDJBRGNBSTGBFXXPSKPKCBFSCHGNTE GPTNUGWWWCJHNYRYLBGVMGGASJOPEVWAIPXEUWEJ JELTIZPGQCRQVDBHWAIUTWTHWOVKVEYWCFCUWIBX AURMZRNUROJSZBJHNJBSDWLMRKSTQACCJIVTIYWN GDDJCBFIEHYPLKEDNQZBAHYHDDQXCUPRBCWMPTLZ CQJBDGDDZUEQOZRKYHBLTXVYITAQROWTVTULTAHP CWRRSGQSJEQMSCZTYPUALMYHTYBNKAPLHJCQYLDR RQZXVNFPFQEMTHQSHTKHTVTPWMRNUORTEIINAPLJ CABCLWWWEUGMYIUKXESRFKOTGIAADFCIEADLKOGP WQQCEKJCYUGPLDJURXRVDGBZBAFPEFDHFDIHDZKO WWZQURYJXNOTODDHNTEAEZHHYSRYOOWNKOYLUSIK LENFRYQOUXUJNCBVEXJJNKTBPGPSOALULLJTOYZD TTSGVLOBTHOLINXXMCTIQUUEZTXFVNLLJEIZBRVS ZCRZEEWXKDDPHCUVEUEVNAWVLUFAPTANZYGJRRWA QDJEXAZAWCXNIZEEUVDOINSPFKMEWHIPJCYZCTFF PYLUHTFUIJVVKMZEVWPVFCYYMTORMOALPWAWMTHS NCULNTAEFYBIGBCHCMDEUMATTVIIFNEEPVTLXLAL QOSUXRXRCGEDHGJKCFCSSESZQCKRUGMODDAVCLTL JJVSFPLOMUWPDCDPVGSYFIDAQEDFNYFUZSJZSQMC QXYEOSNJZXNTEJRPUWXKKSYFZGYYPHFZHPHNRCYF EOWPXQKFYLULWLJKIJNDZNHLCJHGULPGWAAFAOMK PHEJXODKFSETZZLXUBZBJJSGXZUOMUIHBMALOHGT OAFKCAJAYTZRREFRASTFDOVXOHWLULLFRWZZSQKH QIGOJJSNOXJQANOCUAVPJLYZOLTKMZNIPKSIYJJS NJFLZPOSOUCALGHEYLGXXGNLHTYXKIFAYVOGFRNL JGPHIXWJFWCHLZIGRRXQGPCITGHOPCVNTMUPRBCS VVRAXGCLLRSVUFGGHDWTAJXGQHDFPYTBGKULBGQY YRGXOYWFHGZMSRZFIJMOZJBRRUOTTMNLULBMIMCH TQQZPMTPHAKSDUTAOLTNYGVSZXDNIHXBGRAVCGMR VPSVYXKKYZXLPWRCCDCLHIBPIAMMHATPFJQTDJVS JRWNSPCCGRQZHYRIJMHKCYPEFYTOYXCBICWJQGBA MVZJJGOXROEPSXLFHNTRMZPTGBRDYHDFPFOGVAHQ NBJPFFKQRQFCUXGQESIPITIDCSKMYVUKBDZZEQLG ZMYKCHDDIPXOROTFXYDVQHKPHCKADJXBAZLFDCZK TIUGKNFVHXXXUHLTCKEKGILJBNNBIWJBDHXCVNGK HZMRWZNBMAPSGUPVDQFNJNIXGHNUYLKZHCNHXWVM DZTYLGLGDVWUBKACOWKLZHZVOJRXLLZBOMKKJEIC MLYACCOQKRHTQJDUSNAWMISALFYPEHXSJLECWJWV UMXMVLHVBJRMGZZPSSAJGDVAWKVXJIMTAJXGEAOI KKRTTCMRHVEKTWZMUYPAHLLJKVSCLTCWVFMPZRJR JXAWTLMIFFMPSAHBPKNBKSYMYRUGQJZKZNYWMUQW BASRXMYNGZWUUHBFWRAI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QNLSQWAYRZYDHOPEOQAQQLYQRJDYISGDRRHUGSKB GYBYYYSTERYMLMDDGICBQMRZUBXDGBWSZFTBMCVK NNILJLWQSPDZWPXCKEEGIVNEGQNIUZMJHYOWFOCR VIOUDCCMEFBPWFYKFEKYQQTGNMTUTECOKRITWQXL FCBQDEAWKRUHYSKVXAAZFCQDBHTMKPBUKGAQZECD DSJMFXFTCUZOGPZUAEKAJIOKKLJEIXAWIFEIWXXF SWHRJBFGLBWHASANBFOHPQALXPOACFZOJCYVREJS CORBTEEUWHTNJEXVSFAYXQSGUJFLIWGWQMTDUCEH DPNWRTZFZAUTWLJCDNTHPZYNAXWIHQKIDOJUWKEA LAJSEYYBMPLVINHKMHHQBXXIEWBCPREZXMKMSXRO VGQRXABMRSWOABEUSJNBJHGRIOKYKMJULRKIPXKD MZYVJRLCDBRIVAZRWIKCAUCLIWLOAZACXJTLUTJF GOIGNKHBYMCAMYWNXRGTIWHWCIPVARTXGOCERUED XEGPVYDPARIPRROGCAYWNVDOTRFQKAZZVMKJRJCC GTNUWYSPOPCYAFDXPYEXKUOAUHSZUCYWQSEOPSUX JPAPYEHXIHUQEYONLCXPOPAJWOCGVYFTRQCFFRQU KZOYRCYHIMUHQBMYIEZZAMKNRVMRJUTVFIHUGIRK BIPZKCMWOVAHOZFTKJYMQXZECRJOCEGDTDYMPOSP JFKGMKUPINEDFMQEGJJZTBMUZGYOCLNLPSRFYCNC QYWTGHHEVFULYMXIEMVKSRCDOARDVDYTFCFDQCJC LXJRNPVCDBAQCZQCQHDHBNCJHGQBYIEAGJOQFOPR PNQPAXDESRQETGRNPJFJDKCMABAEYCDVRGPBORNC ETXEZEOUXKMSGTLDAAYIROFTYIHPTGTKBABYQIHQ NFHBFKJBKPHRMNEOCYALFZDKMIQVBCKRAOFKCKXN VBKIMDQEHBWGWZFMFACCPWDLHNLMJGNLPDBFZKCX FZBHMGYTDVJTSXHKADNXKFRRWZLXVVAMDBVPUDJC ZBXCZQRROOSKKTZMBYOYFZZZNWEPQRJKICQLCQER LWFYNAWSAXFCOIRZVDKSKPYTHKZBOGBNARMVQMEI LHDLGKTPWCOFBLNAYANTJNSAXEBGFAAXVWWSBWXZ JYUWYBHDWIYJIEDMMTMDKUCRPNRRFUMKNGZAICXK NUGQEMMLYEVYKVUZJOXYENHSXOTEFYHUCIBOKBZG JFUEAMOTYEMHYNLPXGIHZZEJKOLEFUSILWUHKZZC ACKMYGFZPEIUCIDNXNHHBLETDRWDHWNQJMKIIJSD GDZLWWTFZNVADOZDFGDPBPATALXVVLELWKEZPSIR TKRCVLWHBUWDCEFPSNZXBHYUZFCNNIQWTKCXKDPC DCNWJMOUGYQMMHXEARXXWNZQMFZIUXTEGYJPUTMG RHEKEVNBDCOFVJORRSLDNUCPMMKNOJNVUEZHDKHQ GQXWNHXYDDUFHRUVJGWVVUAOGUVQHQNBTEKDMHYP WTZKLBNMTSSAUCHPPRCXSMPKZIFFSLZVCFFHZCTY BSSHBPQZGAKNKIOKERPKILAPGRNKDKMABAJTEDLR DUGKQRTHIRBXNDHBVTQDUAQNIGVRRVJILORYGOOS KHVULEWAHTLRQNINYLPKSJDFHYUALEWRLEWEGYCK JBPMVRMHSNPRHZBPOSESFHZFCCDQJXUEZUDTEBNJ VTVMZCRRIELXLRDZYLPJLSXCSIPLUQRRQUZVOBCH WHFDXFSTHWBWYMSRFGOZZZBBJJEKUMDQROGWPNJP GPYPWJNFYVVCWMIDADRUNVRZQUJFBFVOSVMYIKEH SVDPBVCUQOTNOPAKDSEYPNQPPQGKPACBALAOKRLL GHQAAPZGFNUYZWWDDGZR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SNLUJUPAXJCYXLXBFXZOVKCGRVGFVQMPUYAVFPPO QOZEREAUHOFRBDIYVQZNBTLVLFTVBIUTLGOFJMUC BBKGZRPMZFYEPIFSXLSMLRPRGFQXFQZPXYQFCXPA UFLCWFCRBHGPLRUWRFBWXUKEZNXOGYZHKVKHDNUH QBFWTPIUCNMTJUDEVDRRNXNLFFMLIYDXMYFUQWTI GXPLQIMBKIACIQXLWNHATEJZHXRCPPHSUTAAPWJJ NAOCQICTLENEVKAILOEXZHWUZBFQRXBVMDUFZXRI GWZFPBVVEDOPEDCLDFBGWFEUMWSGUZFNQPIUITRC LEVKYNMNFLGLDIREMKLOKDCFELNKYFGVEPYXPIHQ GKVVTABJPKNCNYINFREQRXLYJFZOQFSNRQXIDLWI BLBSUPXRODLBMIDJXFFKTGUCZYZJDKJUGFTXLRLU YEMOQVXJEKDOAVMIKCOASYAWPADGKLZLONVTMVEM YJMCEOUPDEAYHMLSZSKWULGZCPUZGQTHIEGDIFHY PKNTROIXAWYKLEKEGXTDTKCTFSJNOPYOMEAVRDFH JIIPMWNSTNVAZKQKQCNEIMJLZQMJAXYYGNIHLSEK GRTIRZDAXIGUQUIAABXGCNKYLNSXMHKUFPCJYGRY ZBIQBOMDXTHUIJGDVAGEEZQNASXFGFWOYDCRIHJB XYKHOYIRNQLLKXALEQLEFPNPIJFFSKRCPTJJTGLT CBHTTGUPYPHGUMEJIEXEQBSPTLFZNQOZKRDBFARJ RGOJFRSVLOSKWCYTQIDJORLGKQMOYTMQCLKSSSZA JTWZRYKHXPLMFPFZDOJJNKYHOKHUDCQHJNZUUWEW KJTZCIEVZWMZEWPCMYAVBQHBDUCEVWZUVLQBBEGO ANFMQQZYIXVCQKYEKHFPTFGMHLHIQQLEIQZMVIED XNQCDVYZQUPZRCWSUKCUPWAVZMKENTDXDSALAJAE LCVNUHJPKAUTAMEZMBHWXAGEBPMWWGHYDFEBFLSF HXYKXEYCPBBROZVDOIYIFJEGQTIFMMDPAWLUIKMC YMUSFFWWQLHOPPYRPUXWTCMKZXSMAMKRKDSDDJBT NKTDDRVOPDEQOSVWZNLCCWAHCCRBGYCWFULPUSSQ DPLOWVVLSHIYFDYBDOWDMUQNCKXOXJXEKJARZEOK VOFGHNSJRCANVYNNNBAVAZXMMSSYQNHUFTYSPJQA HZSBOWZLOKSTCCDMHCPQQSSIDNCCGWOFWUHKTPCX OIFVZZXUGLNZTWIVOHZRNYEEQDWLBYJTOTTBDXAO RNDHDJQISBSCGGMFKWEJIVUTYADOJDUVPFGPZSGT NIYXLQDBGRDBWXBKCCBAIXQHZLUZSRFQXQNRRIMW KOBPIAICFBSRLHMDARHXKAVFUBRTFUVZFKVSTZOA ZNRDQDJUNYYSFMVGSXYRPSQIXUZXXBHXQKXJQAIP LNIRTHBISSHDRYJLTRBFJFQHUECVMILAKZBKXRKW KGNEMVDLGACXLDVGYKWSHKOOUIZRLCABLYANPIAO WVONGVQKXOGUYELUDHNHBZEMYQXFOQXIGEAGQFSP SXLZPQNNTFUHASJJJBGIYALKVBPESLLMTODXTXNQ BBUIXWBINQJBWKGZKFEEAWDJUHCWZUOXLMOHMKYL OTMPRHOMJTEBDWWORCRZSGRJBWVZZNMPXCYJNAKK RFRNVHCRRDPSRFNOMEOGCNQORSESXMENPYECMZRE QHGNREMVRHECTBEUBLKERYRHQMNDEPZHMDDDBIWO BTYIIDMYDELLWTVAPABYXHOPZIHXSXTLZFGTYMCH WZWJPGEANZHUUGLBYTVTRAJJQJIWCNOZMTRNASHN VQBKDWICUDLVHGSSFOZFPHFPGMUMHXAOHWWBFGPO NRIAGIMZQQFXNKIAIISE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      CSHLEGMYODIOFKAJECGEUQMFJYEWWCUQFUFLUSAQ ULBANYYTHNWZNQFUESCPKNWNJCWZPDWYOLPBLNFE HAKWYZJPKOPDBZMYAWFMBDONWQUJLDHZXEYSJWQE KTYTCNEQUIHICDQUKBTYRHZWMGHYDBXZQBVIFRBG JSALXBVKECMLFUZYAXHOVCQETTBNJOPIAQNACTPI UYLZCWORYFBQOHLAAKCLPMJKIAFSDALONWWGDRZV ODTWXGFUXZKTUFFNJCNSECFUNNHMIUXCHYUJIPUP XFYNZJRWABJVEHLZXIVGZPICWJPVINMAXGYQDFYM WEUIEFCDRZWUKSXXFZMOTLKQKIULGNIHAXKOLSNW MJHUKZDCKGYUXPXYWXHFPTNZXUQYNSYICZSWBSVZ AGQVQJBRYHNNBIOKQDNHLNCGKXZKATFRVDMQAYZV YFFKXAWHJNPKEXWASXWIBKCDVVYVZVMRVAYXTFFO YKDEDSQFYCVYEHKEESIPHDWKEDUZQFWIIRSWTHEU DEKVDGPUBPIVWYPQUSHDOVDXKUNDSFNCOUGOZCNZ DELRQGIKBRHCTVUNKJKPUEDRGFNOKBXXXVDLKECL RZRYRMAGMUSIRQYHYPGBVNZPEFOCWGPLNYJYNKZG QDYEABPDDIVCRUDTEWKCTNIXOKYENIZEEZNTDLOK JHHJIDFIYGFTZURJDCIQCRDXHDQAXLJYPPOCSCPH KEDBNOJXRHOEOPNVBVVFXQIVILPVHPYIWJEGJWIH YSQLXHRMUKCGTBJNSEXYVLZEBTDWJTKRHMTFJUQH BWMXRLAKQSQHEUZTJQUADHMJEJRFZEIKQTCHIRFA CGOLQQRSMJLHUGLMAHQVVXTHYYGCEJNSQIIBAXKH AXLRYYEPMPCDWPPPUEIGLCWDNJQFYODPCDCDIFEN IEQNRDHZRECAWQYLZQZMJYAGSBGHXPBVWJYGPOTQ JJQJVAKSUFHNNAWJFQIDJHZIGKNJTJWBQTOCPVUO LESUHAHVXUNMZDZBOVCIDBKZCWNHQLVAYJEIPHEN LECEQXYTCHXNSXVLGCOSTKRPJLMLRMPSCVDMLLHB AHSXRTVXHMYTKPLJUMKCNQRDSOLQMHMCIALQANEA LBHUTQUQPVYAABAJPIWHYACRUAAQOAXLEVGQOLGM DVWDLBLWJMYUREQXLHUQHQJCEARMSJDGHUVZPKAN MINEKYAXDXJCZFOUXIWWHBLHBZTRKIRVLOZBBVEY UOKVNRPMCIQIVKSYLXOOQQFNSIQKHLCHOCSHVJOJ NKHTSRDHXHRKZYGRGQGWGLBLNHFFXLWWZUQMTGPB FNJJJRAIZVZNBFTUMVDTYYVXHQYVLNFJDOEPNBJL EVKCMVCOICAMBSCXJOEAHTCQWCBJTDINUDDYXQAH IZVYUVUATXDRBWXTIYWAPHFIOOPPFTBPEGWKEVIU SSLUXLJURYXURLASPNNVSYMDPBBBBXZBVORRPCST GPTUZAXKLVXAUXDSSVFVRWWTJTXRVGBGCFFASUON NDNALDQFEKZNXZGPURPAOTXGIQNDNHSRUIYAWJZH QYVJKVTQLBYLTXBWXYCXUUGGLSKJPVNDEFNDZCLY FPVZBXARTTVVBJICWJVQQBUQHMRSTYHDZEQEJXSJ KBADSAJKZXUTJUNOLZJLMYIPZUCFYWVNAJDSFYVI JHUKAYMVXJDMOZPEXOTEUQESCTTRDLZWEBUXDQJV CLRIETPENAITQBGSDDOFBPGXIPMCYHTNMGNFKPHY DYRERXUUTOQBILCZEUTEMISWIVLVGZQCGNRUORPF SZFWCGCBYROWHFDHTIPQAAQRAQKYOQASYHDKWTJY ZBHHNQCNTCTYPZLTUUEPFQEAAZTKLZQOHONJRSPC PLSOIMZEVUULXDIADMUJ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      CHXUKOEOHIUNRLAZEURFPBYLIFKPYARUSIJGXSWX PTIKLVHGLTPBRUQZYWDHDYDEKAVSTWSGCVCBKQDN WMFFKOMCHMVEPQJULDVBZLNOZZNAVXSGUVQXEMWC TCRFOPUNFVYQBJZCDOGOJTJPPDRRTGCSFVWBOOWO YFRQEJJWSXLUGILFWGAQBSZTAARGRPTHTAUHMKXX DIQQBQEPEFBMUZHZRFCEGAIVGIOIWFHWXVLAWKHZ TUGVZRMJXNSOARLPACSPIXEPSRLVPVYICTAJVKQW HIVYGGOZZLTZSDRSXYXZIUTVRDJNOMKFYYOKWAVH YXDSCOIIZCSZGKBBLPIRRCEGSKENEFWTMUYAZLIA IXSTPEOOZGPCRXFVKFPNAAJDDHTGOQZEXDFNNYYC HAQEASTEFICMVARKQCTUXHXVSXGRUBLNLUBTZGXE BAZQCZDZGNHIJOQCBXMDLHCZUWKLXXLSPNVOVJVR KDIOFJWQNVSSUYZWSWDELUMMWPPJBETODQFQQHHT BPRSHKOPIJFNQRBXOCZLUOBGWDCHPDZCUEBVAZCA QVWGIWLBCTYLYWKYYBKVRHBJBLADEDBAAPDPZSRI STHZWLMDIVJALZHLAKJQLMHWWOBIPULODZSLUQOU YXEKSJRVAYDWOCRWNIOUMQWPALIVIBDUCPDIVJXF NUEOJSQGMQZVOGSUJMDORFCBNXUMIULEPOPOPEXY HCYQJNUPJXCGNJUHGKAAMAEPVREBYQUIFTGSGONO KBGDTJDDYTXNLRBCCOBFUDMHHKGONDMSXAWUBRGN DJQXJMIXVKSOZHYLIWWEEBJKVJOZPWQKSRRGBPRD RLDOPUKCYEJRCSHKYXABXXIUILJKMGCCXWIXZRXS FIDHTXLGUONYDHTRKZLFWRDTUOGLRREQMYCJJVUA ELCSLTAJUAQROLKVYFUQGKBQIXCTOLMITPEVBKLQ JTDTYFBFWFYGDUHQIRMLCFILCRGKTQDVQXKSYGSQ YFCHMKNYSGFWHMABIBBFFJASYPHBYZSJKOMBBYWJ FWJIWYMQDTQNOKXOVCOGNQKTAWPKGWQGEJXQZYGB IHCMZRUMIYTQEOIAJARZMOYFMBPZEVWRMDJJJWEZ TANULPZSUECAJMHGGGEKLKCCWDSZRTAWNAYIVNQV FBLGQPHGMUUFQRGHTZDUGSTKYEYLISYTGRXWUNAS XBWSKJGHGQXIQYVJYKLHZAEOKABXTIAMKJQYFQBN LJFXNUVKDWXNSVUWZTQFBYTBVAZDXEJGUGRJYIIF VAOFJVOYJDHAEUQDWGSWZOJTZIHHXHOFGBYLRPYS WRBNOUUABTWHHUJIXXYKIUAPQHJLCFBEJDJCEVNS GNSSRGBUJLKDPLMXVWNTDFASWNMSGZMNDGZKIHCS FXPBOAQWIWPRCPYTWWTLUNQIETOMJZDSTBDXQICD QYOVUGPSYYILHDCQSZYUKUSMGDXHLEIWLHUOBRKX AHIPOGYOPSVZHIIXWAETSOIQLGAWZVIXYSDJKSPZ DOCZIEIDZCKBXWAPDMYCNYSSOSEGPVRUSSAVEWMU WIHYVKJZNAXYHRPQHYNEUYCJOKWTGQRODNAMKCET TPBZKQLIBHMAGUBVJWYOXFNARGRAXSJAHMGCRITS VMRUWXYYJAFMNERDEZZMMJKFHPAEXUKHZWJKEADT CMPEGFCXRIKOYUIYKKCIZZEOQWWWTXDWYZKDIALN FUCQUCHWARLTHGAUKXKIBHMNZECZJPGZUSWLUAXU UBYPKXCFHTRQXHZCNZOAVJDLKNFIXWRWSUIAPFLZ OKWSYRRPAUIPGEGDXEWEDOEUVKHJRJTIJLKPRUGE WQPRADHBVCOTXUBYPOZYIBMAJKMGMSFSLDDDXTXS EHBWEEGDJVMFHMOMVVCR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GDJKQSANTCHZUUHHUSWZOYOYWCAUMDAAUNDRXWSN CHBRFEQLYZDCQJIENFSIAWIXGSOLTVKHXHPPZSAH ACWUJYRMUCOXMRUKUFDGQRFSWQXEAWAZSZYIXECB FOJXSWSVMXAFJFAYOKLMWXFROTRINWKGBPSCCVGJ XMMBTDWUADFVHHVEVOERKJGLROATTQGKMWBRLJZC GXPFHTCBNCUWLRLZNTOMBWAQVHFAKFLKREYLXCSN TQOVGDEWTOLWAGMMJMMZOWQXJRTGBPTFEAVBZHOC CYDXOYKDRHZWJWPAPPPXKAYUPUULFXTRYFKATZYP PJLPMDGGNUWYJRRVAOFJDNZTQIOTJJJKLMWZWUWR GIWRGTILBGCXNDGWCZKRLYHWLNBDOESHVDGGRQQQ ZSZRJYMALTZNPPHJRHDYIPLBBFJAJBXXDZIYIXFJ EKWIIPFHMQCNVNZCMMJFDEZPDQSWSWNWJVZSDTZY XRCHEMMILWXXIARYPEAILRGYMVDBNSBEFEKVSCNE KXRHBXOXZBKUIATSNGEOFAWOSCABTUGVPZMKQYKS HAMPIPBFJLNICQMLPXULZRRVSRCTQFXLGCPHPNDE CZGDWWSPLHMRZJBOKCXKZIXBLBZHFWZNOYINSXXV RTNARCCLEHQDOASAUOLJJNPEBSYFSWIYKWOEQSNC MFPPIYKDOIRRJLKQXRWSBRDGQJVLPBEEZZJJMBYZ XMIZXIYTAIRBJLDBGGXZZQHJTIXOHYTISMRFJJXH YPJJHMRWJTWGVKOJVWEKQHTTCEJPLIMFARCTIKHP WTUJSVEBUWSSFRUSLRTAAPTFJJSIJXNNXYDIPMTQ ACYLAPEZAOAXUYVTIPDFBPNLQXPPNLZCEFRNCZWF ANZSNCMMUHCFNNNHJTDNKITNGYNWEGYUOLRJZLQR CIPWDPCZKDPZRGMDJHRBDRVHRLOQLFTZOFVVRODQ RHLICMVEQLPGPMNXXFEEXRUWJYXDIXKRNDJLHYTF CUAIGLIJSJEZCYJTLQHABVMOMUSJRDYBZXHIOCUR OGYGPIXJZCTVGYMPMVZJZKMZRMDBTCWTIWEBLRWK KIGZAWUONHEMBGLHCZGHJXHDRJTJPSJZXGNOFNEQ NVEURSSNMVNENBILLSYFJUJBLJZDFEREGEYYNRDO ONGEJXFRWAVRIKZVCQBLTFROAEUVOKCNFMBUNMRX ADJDKVBOMGOFSONKCZCKLNXDUPDDPPMPYWUTFDPY SCTIHEZORPHOPDFMCJHGDRFRZCETZMZSDCHZXNTX RLOKQGSFLOWRGDZDBKAGSTYNJHLZDGXPRDNRCSET QQFNVDRYANOTMOYKYGWWYHLHBKLNRMSZBNEEQPCF FYIINMSTHYUHBJRYWTGUVOOQZRQXRTMNDNWEZLJO FVFSQSGCSPFBNHMPLDFSUFTHMPSFLLUFKWRXAQDN TIDIPSXTOZPOGLTJCVGTOCKNKXXRBUJAQRFRLNLA TQRSQSNDTNOPLNEDEKKDLNKCZXRWCURJJREZYWLN SPHIYKIGOYLXDFFHUHZGAJMDESOOBCCUWWNNSFRG YYKXZBNVXXVLRYLPEOJOCSHZBHSGQDLSKMEGRXJD EHSERBHUCQNLBMSXSNCEHKKZAAYBMFFFHGXNMCNK AORGPXLKVMQDQFXZMCVTZGMAQYIZWGDALWCAZBEG DBQQLHWEDLSLCMJWOQNBETOXDFSSZVUEMBAHPLKW ZXHIQCGHZQBLZTERBGFUWUHCCSJPAPUTIQVOFBLH ROMJDIPKVLEKPXMDEQRCRGNCCJPHAARCKEESIDZB XZOUQELQOOLYFRFKETZIAVSJZCZGVFNFVIRQVSOL RULBVHPZDDBXNNCOQQSZMHYOWYTZRKDPQZIPJYPN UGTVAGSVJYYBDVDYLFRX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      MFINJZHTZGLFCFMKKIEJLCQDXUNTQUEIUVDYVQTO NAUXQYNIERULEUREEAXSJJTKRJSSLIYOCXQAYRZT DRZDKGEHFRBLQXDXSTLTHIQCCJPAQNHNBBNOQJCM QBHEALNXCBRGTMXFDMMUPTUVZFRJILYJOARKSJUX LALGRWLDUIQYLEICZYIZEPUGJMDKYNJADAZPPLMS VXWMZKKRILGZYGNKNNIDHCUZSBYXHDAMETDQFTRW IOXGZWAMGEMRBBITNNRQYAKIVSGLLYWXVDNBBAXI ZIODQFFVROVXJPYRHYQNUFEIDUEJOCZUFLQCVNBF APECTMFBKMGAMQFHPSPWHNZBLKWKEQOFDYMGWTLP YSJDKMHXBLJXBEJKSMBLRBYOTVVQXSQKEWJLTYKU YLCWKCTKWUVWTMDOAVXRGJUPHWIGFDPSQUWVNHRC ILTQCBFFABHMBJLUIFFTTRGUNDAYJKURQLLTERGP QPDHTTKUSQRPOVOLLWDQMSHWSFFYVJJFTZWMZKDT IJFKPKVEZRFUQNJGRCTDLKHWFVAZLSHPAYTELRPL QEWYBTNYLBPQRQYAEJOTNZUIMONQVUCBGALZOBXD NCODVIXVKUVHODXERJVHMPYCJHJTHOIUSZOBXBIK IARXZCOGBHLRLYMJIXKOSJYCRHJPPUFCRFIEYFAB FWHYZPLLKXKNPHIYIWXUOIMXDSMMWKREUVEQDIMT OPFCHXTXEOGIVITBPQOFGCSPXDJQPGEJIMXBEONT EINVPZLWXFLJSVOKIAQKBYEHDKGYPSJABEKMCYXA KPZRYSJYELDHYCPAEZHYMVNWMMQZRGEGDGUYTACI NLOPYCQQQCQSACRFOHBWHITJUDSXNLJCRWHHODYC VYWHHIBQQGJGVRJIWPBNNCUDHKICRSOYAFXGDYXS OGTUJQUYNTMRKVVFNDVHNKHMSQDYYQBVZFKOJJPF VTZENWCCBWBPNWYAUOPSCNBKKGJNNFNPEVLRGYKN JMSMWEMMTBNIWNQTEAACYFFHXDXWUBKMHJKOHLPT EWIJOXUSFAZFZGDTFMXVLAJUUIOOVNCRFHCYMOCR CEDKDLSJYSXHRVBQMBRXQRHBASLJMECCQLIETKMK DZIPFTXXRALULHMRQAWJITRRNRYBCOYYPLOKTLLD YGNHWWIZNNLOPGMIIUVAJDTECRRXRPIIETTOXCLC ALQUGSCNDEDOCTODFFMRXSCXENEVWJVLSHSSYUPV KNQYRULRLSQDDAMYCNVYBJGOBWVSIWOFLKZAGMPQ LZTZBMQFODHDNIKSBVUOPOXYFJFCPNAZPMTFLMGV YZCIODJJNZWUTMHVHEDEVMOJPTOJYNKVKQEUSKUS URTPLHPQZXIHILEUOFDGFYZMSMJSBJVAYKOYBURR PNOFURSULUGOSPQGYOMCPSFEHQSTAWSHNUHDQMBJ AQWOJFKHGJORAALHJJZGKICJHPYWIPEBWJUFFUMH DDVCYSUCBRTXBWAUKXRSTJCNDFBGEINENAMNFKAY PCJBPHIILQSKSSHJTVWVRAPGIYWESRGJYTOEQWTB ECERYCRKLGIBCBYTNDFYMYJKFNNGPAHPOBIRGUIQ QLZEIWRDZYUAOTFQQAKZHEZLXKTEZUHCVPOJBQMI BBTIPAVRPRURFGTIBKKAXTDNQFFIAFAODWGYSRGU FHSZVTMBYOPBDABMCGZWIGCSHFYBJZZOMUIHUCXK ZSHRUXAVAYIXTXTXJMKJNERQIFGAYMEQWUPCJFUJ MGGCQWLJQCZOBDLNSHGBXWFVWRMKUWFEPPKHUBHU GDDKKEWKSCONQJWLRPCSRITTKLFDCWGTUARCXATG PHKZNYDZRKLDFEGVNJNSNMYADBCRAIIBKDONCZQC YPBCSGKQGMIFTOGEQMAF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      XBPAINDBDOCRVSSXQJOAGIVWRIJGCYYYKTAPGOYY FFKTWTKWWWFNZJKULSIMMNMUZFLMBJFMMCXKCEHW DHALFCTTDKPTPDIPBXWCTKJRTMBXRBUWMQCUDUSF WJWXBDSRVIXXXPYOIXFRGNQSEFMICMFCVYPWGWNU XKOYLKIBPEDUTVLZWJZLGNHTNOJBCPCRBRIJJJEG QLIHDUMBPEEWUXWXNKPGZUFDOEVONDNRHIWLQWZY RNRHFGVNDACOUJNELYBDGVVDBKONHLWDVJMJKSKH DZIPOIIZSSNOKTXBQUMNZGQNCIKPGOMATBKKLGDU PWKNUGKQMTFGQOTCBBJFDZBVUIQISHUSLRZBKCEN DUMPDWFLFTSQZNEPOGGKGLUJYFNRZWQIPNLJFLXZ RAYLFQMTUZMHXKZPNPZBUOPTYFBCMUEDYLEPZXUD OVKURZDWKKDHWLQDGAJISIUCYSJERBZXLHYUCDSU BXXXCCIZXLJRBDHSWOUWGIEMNAOQWGIVFFAVVXKF AABQUHVVGGPPLJDQRSMJRFQVYNYOQUOYGLFCUCQS ENVDZWFGYZMMZGGNSEBYTFWZPYCILJPQFCSFCLTO KZWHBAMYJEVKOJYVXWPVCVLWBMIKIZUMMQDIPVYH OGRKRYHJRRUGJOBUQLACHFEYMBUILTCNMDBJGAFH QFPAAZOJVRMVVVMRRIDMEAXGURSBCSPOKAICFPUN AIMSQYCXTPXAXJZBOYVKASNRZRMTHPMIHVMUEMPB YJNCQGDBIYTTBHZKGLCIOIENHAUOPWDJFYKTMXEW MWGOAKOHQQBCERIWPJQGSCWUOMXAOUEUTFGMHXTX XGKZOKYWIMSTMBUNMYRDHZYIJMKNSVGZCVIMOHHD VPAHGILBTHDQCYGELETVMIZXIGDCMOLINOSBMFBU GHTXBFDTAZFNACXLMILDTYAIPFHCKDOEZYGCSOJB OJEBPBJMZUMOISTSNKFCWCMKKVOSLZITYFTKFQNY YZXYQPNDWPPBXQCOTUMPWWCMHMVQRSGRNWNHGAYL AYCKDQOMNKAWCTMNWXFZSUOHHUEHXWFRSMFWZTQK JQVQZOANQILYQTDBWQCJZVTAXMIZMHHKYFMKCQEQ KLPXCUBKTWKJSWEYMUYLKLJBIYMCNATSOBDIAQQU STTAOXEMWGBNKDLMQIRLMXGQCAMOENABLGUPOOFO WAIXTBDLTVXIWQVELAANZWFZFFTSDRHHAMZARRME QWVDXVJTOHKKIWZUTWFWAEZZZKUCIKGUGPVOEVSP QGNQGMMYOSQVOILQZCJYUDBLKMOGHYTJWPXMJTGJ KAQEJBZTWCESOYXVAZYHRSCKQWBFPDFMYKOPKNFG ZDCEZPNCJIPVSTHFZDDMHHKEYGRPZNMFJKWPTQBI RJTQGGVBKZFOKVAZVFIGUVKLGCKNZEWPZOALQHUE FJZNSLRDTUQXFNCGFIXXLMNQBAJPSJXKKIFZDGZT RMZPWWRFFJAJJIEMVFBKJAXBBPXDRCQYUBGLYUNB RVZWCHFKHTCYAPMGYZLKDNCBJGDVGXCXYABBKSWL JYEZQUOWXUCWCUODRKTQZFPRDZPINSTXUISTKEYW RFCEPVMKJOKYBETEQKICZBMJUUPSKVSJLIRHWWUU KOEYQAAVDHCHKXAZCNZUZEDYPFULIVGHJVCFMNUN WQHBWTNRQKJODEDXBPWOAFHLBGNXHQYBYYWERBMQ QXAQABOKPNRGWVKCQLZGDDWMGSOFIFTCOYTYNFUW QWJWVRYBEKSGDKFEDJXDNJSXMJZPUIXVDJFLWXFI OFDLDGGCMIEUHDUJBNVHVQOCRPSRPHKZEUPEDARV WKUJWDNJGDLNYAPOASHFVUMXQFXWUSPYSSHZFLNI PYLCJJGBIRXPMMAGCMIL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TYRFIAGALYTEOQJNIFXYCHEKMBNNCLYZGHAUHRCE LREMBXTWFSAGOEIVQMKVNEYEOHMWAWGIAMIWDULT GQEGJDCZTPVXITHMCIUDUXEMHAEQASBGJOTNRHLM QEYFMMULWFGVDWHJFNWFLWMMDKIPJZNCWXXHGENK LTRLGOQVMBINIQWCNUXHVETAEVAWHLTMNXIDCSEX SXPLDWEMOBQZXNRGYMXFESPXNZCXAKZBQQAJEIRE JEGUDODZZHEUAXPLJIELGOOQNQFFQZOZZQYODSJI QHSGVBPOLHBBBVOKHWWNQMMSUIOTUSHISEGULCRT EXSGGWLFOXUHXIYMOZVZNQYZPGYAEGLJHCXPMJRZ MYDJNJYEMVUWWPGNRFCAEBYVLQZAMMXXSSYAPEIV LHAXTPRKEDYVJQXWPSPBRZTOHLQWSLKBAPKVNUUX SRVLICNAKZGJEWTCZZIAMMRAXLWSYTWFXZFRNIKY PUXOMNOMCERQDUWKSIXUHGGXOAYVIBOUTEEEIZYR HZMTBMRKMGEHNYELBIQZEQOZHXVDDFRIPRUPEFRK SZLQNNJKKMVBQFCGXRKLVTLULZIUTSPAGZUVEMES TESGIYTWFFGUYNADRKNPIACATUDDCASPRIYWDBBS SMRCQWXTLKEUWSNQJDOBSAKTDFPULPYSNLSTONRP ERVQYGMQPDADYXOJAYUZVEBWDPOZDGGDGGYOVZTZ ILHOAMLQLUWWXLQSRJTNAANWIFIBWQUYBKPAFORG XSAQBXHCKSPESQYRKMNNWSGGTBAWYMCJNXXWEOAW SIVJMCBREBJUGKJRFPSFMSWBVCXRGCKXSOJGKNYE LHIMDDWXLUSKTSNAVAQPYXNDOXMSKTAXKFKMULTM TLKMDEZRCMYHBXBQNYQZPBZXKPYLXMFWNAMQRMWD CHCQTTQRCOISESRLFIFLTBLTPINQENFZFZYNVWAA MMUCCGSCILSJOPNEFSCLICJFTZZRBAZJKUCXBCHD AUFINSNGWSBYMHSXREZKJEQDOOBRDZNYWAKBFDOK KWBJGUOVJHHWLCZZRFTOIDSWOTWNMAMPSCRQRDFA YPNJXKICHVSSLRGYTHFYLOXEYFNQMIXIBZJLVHDG VJKCWBGWINPQPBSVHEHVTYNQFFDTBQPHLTQPKBVY LHJOXSJHVONLVZECASZWGNMJZEPPXSHOFYLYKLIV AYFWTLFENSIXNJBYPULURYJELOPUWVPGSOVNIEGK MRYJLEAFBVOIZJOHMVCMJBCHUHZWKBNEILNQVGIJ RQJHUALRFYEKWWBZNTRWAWABUPAARBRLUOOTMCBS OKVBKADRPVQOTFMOFVPVLUBHARDDSUHKPHTFBPIM GDEWPVKUMLZEWWEDOAKLLSUCYQCUXUNSIFCEYGBW ZIQZURSNWVLFCXURVFYBQZGZLWSIMFXVJYPTBZVL SPCVIUKAINGPGQMTWTVDVIOWLSFAFGLAQAJBGBQX EKZAUWIORNOTIMIPGMFEKZGWUZSYBOQUAZWKKMLE WQPTHMEUPHNXWYTVHQVONDZQNPJFAAYQOHYKVOLO WWFRJPFBKXJESGEXIMQAGVOOGHLLPIANUGVJRYFE VXMCCJMPFVRXFKPNEGZNSPJRBMXXRXYJMAGFGGVD ZQKONDRWAJYTSZTBYAOKDHYRLESLPNCAGHXTSXRD UALBJBCEYLTTFBYEDGCZFPVYATGCPACAZJZEXRDG YSTUUPRLNSTAVKWTWZCXXFCSPFQAOMSULASBBCAZ YGFVXQGAQFTHEQXBPOYEDRCMMPYFSLQPTIKFUWNF HUJEHUDVLUADLJEDNAGBMFDBEGDSACURMTXVPZLI ZGSXHPGVVNXPRVBLUUIAORVTVLQXWKXQTMWDTYEO LVDKOXLPNNUDOVEHUHAF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LUUMDDIOPYDNZWRJNHOYUSJHXUXNFNZIGNAWUUFU DZRHFOPYHGRZCRJSYWQWADQRQOLGBQDIZPQGGCPS AJXWIQKDZTNDGYIQYYGTUCCVHDTGKSLEEKQGDBCC QASJWWOTISYSWJSWUDYZORRUJKFDIPASJTQMUGCR DEIJILESBMURCLGBOGGBCZUSSINMWERIHIZHFRBV LQEEEVGWRVRJFOBZTNAOHQPIJJJAXWCRSDFZOOYW GSKOICAVABEIJAVIQCOCJJQCBJTJPSOOPLBPWEUC YUBDRUWEIUTONLOWSNEKCAPPKBGKGKCQIGBPEIHO JLIUAGADRBCRFPZFIUJYYHFIOSITMOCYWYBCGFGP HUEUVEHVKOJAQYPUYQNLJEWCGXHNTWKVFZBWIGIK ONFLKUGVKRCRAWJVBZTBEJBUUSKEPWEPYNVTNFKE JYHHUZMIBFZGABQHYXQFMUGQJMAZOAQJRTVEIZGG XEPRSHXXQQRYKKBUHIZKWZWRINCRIOYAJZCKLPYE AAJQCQBXWWXPEVHFPQTRNQODDBLJSBQTAENGMIHT ZMUGMJWWOSUHNESKXPCLKDIZSKLINTFAIMWCQYSN XHYWHSINWMEWRRGOOQJNMYQZVHAHPOWNAIFNVVTV PUSAEYZXLBIUBJJALPMUSAODZAHUOXBIODXXVVLX XPFMJUEDKEKGOSIQDZQCJVIBEFPCVXGYPXLNKKKJ ECEMWLSITDBPVGNMOPRCDXPSWMIBPYUEZUFVRHXA XBKILSKDJAYSDSLHYTUZIOCNLHVGMTOMVJLLHNKD XRADRYFIBXAKFLQODIAIUUEDLQUFOGIQXSGGNPTB EVECNSAENICRLTNMLLQKJCMFVCYZQIHTFVPIDLGX TCODVIKBNSXUCXNGCUJPGSTPOOKQCZYOQZJUJNOS EHJJRJZCSCOPDPMEIDHRUDEIYCQRWKNXERVYODOT BRPWFFYWTSGHIUEXMQSPGFWUYDKNUFEWMKKXZYHN KYPCLHUWLHIWOCSVUYOEIYHMAZBLUWYSYQPMIFTN IMQVVDVANYPLDSZGMMXWCDLOEQFCONPWCJPQPCTB LQSKEDKDLKCVXMAHIEGYACFKFUOQLUFSRANEVHNY STKCBBOHBBDXRKLQATCBQEPRIZLNHVBJRVLTTMSN FFYZFYFBDVZHFMBVDVVAJLETVCKYKZKFIVUCTVPL YSACVITIJMOKPCCTTDSQWQYEZFCZMLNWAEMBFGDQ YOOKVYOFVRXSIAQOVHBFINBYYMTAOHHALDEVWVOJ HPKOZLTGVUTEEUUFYKJOSOYHAFWCBUELDHBIIETD JDGZEYSCICREOYDWWEKLFGZULLKVWKLRAGKUTRKA OWDMUNYDVEUAJAOLHRYYLLPGHQHECCGBCJHYBWFQ ZCZEBYBAPQXEMIPLTJHDTMQMYOLLUEVBTFPXAWMR SHUNOSFILLNSYFGWMGUDMXGNGWKYLLBYXLBESLAE XEPOXFBLFOZPYSCVCHZVAXJWUVVSOCKTYOHMUUQX EBIUHNMFCZAIRAEFARDWJHXEFRAZTSPVSNWYXBIU FFRQWLMLILFNNGQRTINFAPOIOBVEHEUFNWGXZZDP SFQIPCUXGKDGXJSETHXVCMOOVRAXGTJSTSOBAUSM CFZQZJTRTOYRXUGIWVSUHNVPXCSOIXWJPHFVNEAJ UVUTFNZZJUUTXWWCNKZPZEWRUXCBWGQWZOIATVEM NNFGRCCMWZDTLORKOULYSLPCVDUZKGHCUHBMGHRE BYTVCKMVSRERGSVKHSPHRRNMDOPWZXXRQSIFFGOI RHYRDSSKYMSPMCYTZWPDDWYRKXWSENWBLZVKQNSM HAZZHSVSCACKQKVOUWGEAKINSLHXTRTQEPCCJUHE HPYNTGLHOQIDEDQLKCAT
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      UUYJCXZHYGDTQCEBLWPFUADEMKIGZYEEBDPKIHSW VLBXKYGNBFUQYPNXRNPIWCAPIWSEQLBWXSSGWXGR ZFDIKXIMYQXTUVJWXZSSDNTATBTXFGCRQCSHFFGS XDAHGSGWCUDGMYPWAYCLUSORXLVAVRGEUHWTNCKK QLSHZYUTTQNCPJNZWLKJHVNLGCZSEQTAHNNAANOP CRCUSOXSHSWQFZKEKQRLGQAENLKUVTZYGKMJVSAB RVHYGURLJGUJNXFUOLIELVHCQVDIOGLBNLXWAAFW DPSBZESPNYLRCXYWFBWKVRHHOVWFEOMYECULKGRL JFNCUVOUGOPUFBTUQNUYWSLFNKCZGEBBKZKSEBAA KCUBIAQTEFYAXNQUARJZCUFOMVXHUVBJPUJXYHQI QMSMVFVXKOGEUONMRFLHRWUKHJMWZJTZUHVTHBUR DKUCTSZNVEWGRSCLJXZNMIUMSCUCYJXTNNURFWDT FAPOJJUAYPOJZOJDMGCMOJAPJSBNKDJEDQKEBION MZDDGPHXNDWIJGBPQEMDLPQASBJPZZCRMXSQEYCC SZZGRXGSLDQRRZKKBCQGUUOVYBZHDKKZGOBBQQOO LBFCLMMMYQEUDJWIXKALCHWBZZWSOSNNBTRYVDXU NKTFJBHICFZRFOZVTUYWHHOFZZKDZQHISYCRAIFZ XGIMIDQWJQIGQFABSOCDNQZCAIXZBAHMWORWCJHB MJAZQAUVCXXYUHVQJMZLJFHCBNUAPBPPEVDNIPLV NCXLVATENQUXIVXVMKXOEVYDHJEXPNOXSRFFYMMN XOUFYGWISCNIUJXTGQHIIOVDBRPXWYELUBKPTMLM BRCMNSGZONECCLLRVLYSVZLQRGQIRYYYPZVVAJAT PIWRUCZEULPRSRVTPDZAYKIPYHYLFSELQYONVHAN RRXXADPSKQBCRVVSDMMWNVEQAQDHAAAHSSPIZJDU FJBKLOWDMJOFZBYGEMDZIOFYLCFYFKGUCQNBMJVH NOSVJJLHLRBRSJOVTWYEBJMYCKHGVQHNPIVTMEDL DKDIRBMFWVMHYJZDDHEWEVOGLHZWWBLNKWGHBARB YBFPXOEHWEUCCFSIEOKSAOYIEJMNGXAQBJYFTMPC KDOXZJQRNAMKPPZAPMLQZOODLMIAFIMVAYYUMXCS LMOPOMVYJDKQYEYFWMCJQOUGOLIHZSXVHRMTRAQO FKRKPAEPUYKRXSPJGLBLWZUGJAPJFBCQTXRTRLAR QTDNSDJKBBJALXRNLGZRZIQYNABICXROLQYBJLMZ NSODXOREMMANAPQDKCMKPDVZBSEYZVZAIKMQFCZI SEQBOLRJYMKJIUUBDHGYAZQFYIFDIUXRQLILDJDW UOKJGGAVLZJBNTYRDDOCSEAYPZJOTGQJGPOPLLJG YTDIFAILNACSQFMNJRCTSMRXBZNEPKRDRNKDYYVF UTQKFGYILOODOSJRHZPZYROSRCHITVUKJKQLXQRY ZVILKDLKANBVVUTEQVALPREVOCIEJNZVDKDMPSCS ZXZCIPMDTKGMJASFZBJFYIQLIHOIXHWSGTLQHCNR DETULDPNDHLQIMFZORDIRAZDBVUQNYNOWEMNNQRP MMXRVVBZJPCWGLLPTMWJGMZTJTGJBCJAQZKXADYJ LOQPXKXUXBYJJLIXXRYPABEQOKHZDUFRTAFUXITM FLOZODAGXQNXZOYHIMJJMNQXNZPSFTZFEARUOJDT XYHSGIEOJUZWTITDZQQPEFDMHZTQZBHMVZVLHAWR LPIRQUMUYZXMFNUXQSMXBAKAFLPGNXFESCXPWAEO TWSHSRBWKSYZWTDGVHZGZIKKDOXWYRKJYPQJGKKH QGNHMKTSRTLUEQYXYJCFAYRUHPFAEKWCPUJTUWLO WYZMMUBCCFEHCQDHBAWQ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GOVVKJKICYLQHITSCIBFRSCLXFYQLTPWTLUUVRBA AVWEFTXUIRUVXLBXZBLOPGLNIBKQNGUSZKZPHJJK FQPPDUDXNUBZLXCCXDGARXAIXNJASQDYADTXJCFI LLRFWJCETILSTODQKUHVFYPLRBQMUGRIKDINHPIX JNEMQLTUEUJSDLFATZSBNPYMVWILVYZNUMLAEUOH NRRKGYVXODIPIBNFLJSGJQIQMOPZEAPZFSRECQCT ORVYYGPTQVAQBORIRNNWLAOHBFEKHSURPHMNKPGP GCOREAECHANHBXNNXOOFHKJWABZUVEIALEHMHOCW DSYJLNSPDFNCVWVELADYJMPAHXSUTHPNAITCERVW ACBXHPXUMWKEDLSCJFCSTDFCWVQJMMQFKBKYJWMT MDTXLFZBXJGBPMIZYTXIIVJBAVLOYBALKBJFXSAP SPAGMWJAQTCCHJRXWZSYYPIMTNHPGAIYSHXVJFKV AWHGKSUIXTKIJDGJECHCGAKTKVCZSDMQHKWRTJCD VAYANAKCKAJYNERZJWMVUYJCRWKZQSSRWLMCUJPC NFOIDYLGAOPUMIOTDCKJLEWSCNVYCXIJCXQDMCHD UGVJSELYAPULNVAYGFQCVXDXINIIAAONXEKXQOTZ LZOVOCCSHGXFWLXQBGOMXRJPHCCWDTEEZFOETXGO CCRHZMHFALLVJDTIJTPGJQWSPLLWVCRHEXYLGTPS MOEOEKOSCWQKDJBZBVIZWZDVMLGFQLOZGOKLNTGI FQVCELXBQNQAAKGRBRIOCRZRHZLBWXFKCLGHLSVI CTGIRYCPKZNOAKTYKZIGTMMDMCVCGERHKWAONSSN MBUGNZCTNTKEVYSQJEUJZSCPLPJZPJOINAHNFSCN RFUHGRGDQGOKFJMMHPJALHTHDDWHRNHSKBCRYMAN MCQGSTMXCWQSKOJNQGZMIZBLORYCKHRGGTFXAWKZ XQSDBQBLEWUGOTAFRJWHEBGSTKOVPXYKWXEREJNS YKBCMVWTEWFBEJBIIQUKIYCCMZICRWETRDOGSZBS BWZVIHVJPPNAIJNYPYJQALXWEEPULBWYTINXVCTT HLGBCMNVFKDIXNFNVDZGPVGNBDCIALNXUDKUNMWH UTQYTVOOKHEZNKQPHPJGAILLTOCGZHHQTXHNWJBJ LUYRXNTWRWQNWOPNXIAFYCBZTVNCLGYYRCHTGXIC YNSVJXQHIAEICSFCWEMPTBIZEBPOWVXLALEOUMMM DRZKMFOHYREHYUESHOOCVNQUDQBMHQHDSXZZKLVL EXYUHXVVZFVNRDQVFFCFTRBTIRNOHARYGZNVMEDJ ZBNOCQLIUQMBHFDBXBWTRCERTLMFOAKVSXSGZDZO PXDTQZIMLKMLXDZOQAQSJLWCXPOBPXQRFXDFMKJY XYEFIMDEEIDULEOECKKPVXEYIIBCEZBQFAHYTRGJ CWNFVIRJFWELAOARRRRZWKJTBEHUGNSIXNHNGOMW LKAIPVHRDBLNHQCGXTLUTRXBORSBCDNIYZWNCNJB EHQNAUYSRVHVASMGLXVNFTPTIYXBEIQIGCTFFQKE CFWIBGOOYQSAIALTYSCTQJLPPVRLFCYNIOBLBABQ DFLKNZUVETQWZCBRXSYPNXVNMXMBQDKEZXELRSJT PJBQOVZAITOHGRWASCJSFOZSSBOMMLAAQKEAXVKV SFPLNPIWAXWUYQTTXTTFUSHMMYFTMGNWIFAMOFGZ ZVPRIZEUCQUGVDZDGWSZQGLIOZKZCZHKRNVCLMDV RQCNHDSLUFUBNZFTHAKJONFUFVFXFVYCSFMWUSZI NZIPRATLNUQJNXCFXAIIOCNIXLNBBIGHDZBXEETL ENCEILVOUTTPYIBKLFEPCZJDMQFHXSREZQZBNSHX IYFBYYFJNTQGGWHMXLBR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JZCCDXULEJGGMQNMFLAKRAGURULAEFDODQMLFPWS IUKANGOMZGRIWFXBNHHTPWRQHPRLEYLPVGSWRFTX WEUVZIHCFXMLROBXMFATWFPMUGCUMEQLNBXMYDDC JWRUUQUCPQCCSGZEQFGWQTXTJWSYLRAHGOPHGSBC HTKTCCIDNTLZRGRFWMYYZMJDGVLXDSZJIPSQQKQA IZCMNPNBTNQUJWLVBEFLWVHCJDNGLKJWZNFUGAHI NPJNRSWTPIONNJJMHOTFOGVEQCPJDRVKAZRJSPMO PGRLJQTNUSNNCHZNVMWZWLMKHQRJVNEDQBDWMCLR PRDCXLGLSERPPSMLDQHQQOQBRDPGCPGCWNEXTALJ EQEWQQLEZYRQJPUDOVSBGQWGDUIEGUOWIURMRFTW HIUGGMDVTDXOIFXQFNLWGTJKNUXLHKKYJSZMVURN BRHCCLRIPQIZXHAYPGNOMAAZHLIQGQLWRACTNAEY WZAJNFOCTDCUYGCGEZXEQACLMIONWRETUODOIEKR KROZJTVONUZDYOZGGEQRTRWGWIKQDIFGXZYTKEEP MLURPNHNVTENEHECGIZVGRRMUJWKRAVZCRBJVPAZ LMNTXBWCDNNZMMMFVIPDSFHGPQCYOOACBSPZFMBE RMBRUSIYHEYDWBMBAJJXVQPPLUYGJPGVRTWIRVAW IZCKOOLQJNSFWLZIEJEPAHKMNCYAKNUYOXUEDTLO DVMTVKMEVVDEZIAIGHPLSWVXRORZFFNAMNMQKRKO MOZVMCFGZVHDNXNWTHEQKLDVAJKBZTQVQFNLCTMN OUINPZFGZUEQQSPDXFFDOQPCKVQUVBMUEXQBNFWT SXPPETYJRHTUWQXFLBMQZJWWNRZFCQYKFVSCIOMA RSAROYVOWRTWFZVISQJWXHWRSPOJGXQPKDVYQPLK QZTQIMXLGRPWWYMBQQPTQVMNPSBCSITLURJCIGNE AWSAYBTFYFVKFMPZJIXJHHMDCQAHYPEYUPYWEQJD HTMZXFNCFLYATHJKXBMLXRHNLQTKUONXFSEMAESL PGLOUWUQLCOZFIODHOQBYWSNRKSLXGBVLXTNNKNE URXFUWRCQLOAGZWVDOQLNTGVQGEYMMFCXXMEEVUF XBOZENIVFKPQDPSADRMUSHXLZRSHGQGGQMAUBRKK OSVMCCMNWPEFLTTHNMUSHEQLIWJWXMGJEEIOIHXF CWEQHIBUUSDQRIARHHGUATFVIHTCXCOQUZBHZXEP XZTAADCXUSOJULUUCXRAPCBUUCJSTUPVTXFTFSQX NNCVIUFIMTUCVAAMYCAFJKGLVFABSZBVKLZIDARE YZEGFRCSIKBRYVNCXUJVIEVWFVEBXBUSWPJUZAER FALLFAHRJEQZWBRLNJLJYSYOVBHNRMUXLYJAQYQD DFNYKRPPMJNEQZCNMNLWJZHNEKTHHXGCPOAVSLBC YRLUHNQAANBEFPVGRQYWRODHCVSSHECNXQAQUERA UYFXRIFBHSHKGJXYRRLFYJQVEIHEBISDLKVGWZWO GMIMZJOUUYQHVAGLNOHZJUHBSMQRYETFWHYZBKDO DKCFCWQAEYQYSMCRNRXBJBTCHQKGOMFRRIBQJUMH JVCKWOLGCVFEKESXMFSTNOSFYSGWXEDABOIXPYNY WFDBYYOPURTLLPHYSNOZVTZWQEMOLXUCLANGZGYD TEIMYFNYEWYKJESQCMJROHQROFBKWHOYARMEFEAF UZPOLRMJCOWKUHTANPVIZBSVFSVSUEBIVEFZOHUA YVASROPPFGNHHYQGCVVEQROMLLPZLLZIKSRVLJNF QZWIOGHIEEJIMMCHJTCULURGZNLTJOLXFXBZOGJH FVZHHJJMKPZDOPREFNDBXPNKSDRRGLUIQNYJOWWB YRECJJFHTVEWGZHRVDHG
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LMHZKEFEGWPRUMNQUFXXVJCEDJKWVVOHAENFCENP GAZCDFMTQKWHOCTVMLPYQDHGTQCLNBKORBTOGHJM AAPHRJOPJYFLFEBQSTHJVMLUBLEZZNOUPWIIUVKS ZCFEMPBXHSRWHLGMLMEFOHJBKFOGYVASMLLHKXFT UITIKEBZNIMDPTLJJUXKNPAUTMYJUMUGJSTLVRHJ ELANDZCAFLEXIKIXASAWHXVPCBFSHZPSZIXNJHXJ FSAJUJMQSBXMXZASRGHBXAGLLTACQCYLHPQRCEVO NEOQSWOECIOGIMUBJFMSOCLHMBLYOJCNSNFQZDVL KKNUKTDGJEGKFINPYDPBZQDSEPVUQIDHRXDADPXI QDTJJGADUFALRDLZNPYJVSNNOLBYSVRHTJJLMYQS LZNSWVURFVYAZACJPNYITWRLMDRFVJVGDCCAZJBI PRJAJEPWSEFINTJZMNOFOYRCXUPMZBZIFVWWSHLZ FZEGHBJQRAGLRTPLJEFAQMERNXMSIJWLGGUMBCMB PJNQDLUHAFABHUGNQIEZFSOUHVZIJLOSWLNUOVBO UQNNKGSXKFBAYHSMEFYTSZVHNUDPSGNKIJTNNMEV WUDHAHDKKXACEQKSLXHJXQMUAHZTPPJUOQGHMDRJ JXNQDXRFEGQWDEAIJNPDTNUVHAAWQONFWJGDBKRY HMIGGUIBDJUBQEXDQKIIWHHHEMCDXLWDJNAALHVB WLJFNMAESOFRXUDFVYPUZDFKIZXKUYFNRCDTZTQY MGXHLZOODIWOLFVSGRISLXZHWDFDTBQHJIWGYGGR CPFVRJCGRRJPCRFJBWYLLRDPRFCGRQPGVEAHEFVF WMTTSCXKTEKGYQVHTCQHWPXNZWGTMBRYAWXGCTVA NUQPUQOAGKAIBGBYYQXOKQACTJCWVRHIRHVPPCFW UAFMNTOSPBHFJTZHZQNLRUUYAWSZJDVHMJYYMZPQ FSUOMLMTPSOFCECGHRNHWFHSTSSVMMHOKIHDDWQV XSQYVKGURYSNFOVSJHVWMNAOHABLKXURBYQWNUOI SLRNDQRYKHPTKXMSNYICLTWYZEARRUFWXVKDVPKW MLPIQGIPCCQVLTOGBNOOMIYZPHFGAHXGEEBBXKLI SRLJUPDJVJSXIXWNPWOVICFDBKUGUBRBXCLZHZXC ACRGAEZBZSHRLISJSHYXXNETMGAKVWSUFKCSPTYY TYDYMGOGSZWKPIPIHUJKZMSNUVGZBUPUHNJTUOAH TUXPCFHJSUKRZLONDITWWCHGIHGYBYURAMOGOAXR WDNAFVUNVVMCCZIMUEFGBVYMIBCHKWYQDDQXKDOF MGVCCJOTUNVQEUUQZLQGKYYGFJMONUIVOEAXXCSE KUNGOCUWBVRPMVYUTFNZHVVOWZBWSOZYRBKGKWHU HTJLGFFJJBRWLRAPQQTOOABIEIIJUVEKFBJBAWGS HZKSSSVMLQFKTUHAQCJYHQTNLFKAODCFKFMCYFOS CVPMKUHWUXVTZKDJPNEMIBSGSEBQFZLDDHLIDFEE JXCHSPSXNQGHYUEOWGNYZQNGSRIOEGRYPGQFBDUU SHJJOLMCPTJLONPXPEVQLKTUEBAFJMXUNUIKOWTS XCFDBQTQUHQEXWUAULZKHZJPHKQAJOLOUQVHUUPK LMUDCITVMQZJLFSYCCZIFBIGQSQFFCLKLZNIVMLU LPIVZWHZOYHNFZRDBSIMIDWJTSNKKYRMPFRDMLDO OGVSFHHKDKIGAWSMJDEFWXWDUWIUTVOGPXAVFLNO WEZHWTEXLQZNHYJVCBUDOUMGYLAKTXAFAYHULKFD RGVRUVVUPSPYRDIRVFNXZYEITTJBNPULIXFJWNOT NPVUPVJMNRVSZLUMSSWUYKBEFNEVYSVADXNJKWGN LRCQYFAQEUYVAXTAJJCE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      EIYMYEAQYADEBAQUVLQHIXKZNCEYVJAZWXIANSBD QUKOKAXOAYPWYTDMFGPEYQNSJKXGBIQRHOUJCOFZ HABZHXUHYFWOHFXKIHZLPBQHAFRBYWMMWUEHNASF VYWXTIROFJOJLSOLLXEIDELLEQJVVKSPSMDCERNZ QQFAEJSSNRQRMWAZEWTMSKYMWSUUPBDCUIKNCHHZ JKKKFIZHKAWPAKBDJNTPMDMDJPSAGPSHMWHLQVQQ QNACOYTAENQVDGTGLXPNVQNCPNJAGFEQCMUZEAAS EHOFBILJGSZSGAMHNWWOLSNOPXFLZSDBYNXFHABH UIVEISMXDCLEJEJPWIUCKKTSIRVFRLBBNHNMIEGS RCVKKYJFXEDQGGZPGVAUPXVYUHRKSXNVAPTDGYGW GCIGPGWOZQHETSUGSGTTNNHAICWYBOKASLIFTFAZ GCWANDWNPCARBARREZBMZYWRWNKMMLSENIVOJYUG KWVHSPIBDRHTAUBMUXPMWHOBZYREVKXOREEHVACP BGFMBUVICCVBTHBSMBYNNPFWYOPVZLQVMLSSEHTZ MWFRNKCPGPGCHHOEYAWWUDWBMSLZQPCUFPICOIIB LKIYOSHPHLYLVEIEAUUCOBPJUEBVCHEAAXXJGGPE CPUZJVOLJZPPOXWBSQRMNCCOFKKTSOCEQWEBHTTH NKDPDXEDVMFYYHUTJJJCWGAMEDEXIDBMDABIJWWC YMMITHCREPGFRHPUQMOHDKKIOYHRFSMLSQUKWCZA KCJOJBQNBUDHQUFCLEQPBBFAYKQQUMIAQLETLGDZ SVDCBYXXDFVLWBCSSUHKMVINVTTGNTYQVOFWCGEE WTJDALYYVOMEVZCMLTITYUSAHAXKCMPEOQTHZTQL UKPUQZEUVQUDXFHSFKQGIUJFHUJNSBFNOGJEUZUX UYXHLBVJBHQPRRFMDJUYOGTTPDWRFTHTPUNRZNSB OISIAOGDUFPITCAHSRSYGSLTINHCKNBXLVQQFHPY MMLFCDZNIWTYBGGJDXXNQJYZPBNZQMCVWQKWMAAA DVXRJHVGHQQVKTIDGUMZNEVFYUJGQVYBMTMVYHOS MVNCTOTOIMSQCSBKONKYSWQTFPSTUQKQYARTRNPG SZNXPTOSGPFDEQWXGVKBFOIVJHEPBLXIQFRXUTXP LRUCIQGHHGTKQGTLHUWEDBWXFQZEXWLTAYVSXZOD LNEYMOQUGHBGAFJRHSWPGEQKKRSALDZJBLRIAXKG DJKSNNTOETLTARATDISYMCFZEQNRXPSEQGTSLWIL VLJODGMCVIMURQRMYMUMWMBSUJRUOTFXSTNEXFGL WSRSUSRPIYXTDIFICSSBFRFPTQRZDDCZEJGCSDOV BJTQETFYQXLHDYYIJGSRADHLICCVQCDDFCAPMHZH QDMULNEZDCSQTRVLNCRAVLKDPHYKKFZZNIFJKRKQ MDUNEGNOYSJFPMIQSMLBCIKGWJNQRLEKODKHJRQB IJDFNJOWSOGPEMBQWCAFPUWWNRWPIIPQKIHWGKLO PDTLGVFPYDRGOIPACESYESAFCJMDEBXJHTGMZSOG XDWYGHUBUXBVRFXYMFKIYVWCNERWGQNMJYGWUTJQ QROPAUBNSJHHZBKEGMWLHHIMLASKFSLEZSKWMZGU QANSGOAMMGTMRYQTLRQPRYMMCCSXAGLRSBGXVFCA TMSXJZBHGFFPNYBTJIDRJDFNIXNPLXJJLJPFNEUS ARVWEBFULJWOTTCSYGJDPKUGOGLAVLWQMQVQIIOW JPUTQPOOKEKPTDHCGTJGPZUIEBLLDWFPNHCRTECH DYWZGBFYKMLMJWIFAZRBQYQCJQRDCEZANCNLBZJD XNJEWZFJDZBJDZNIJGBBAYOCUKIRICSHYNAGRJFQ RAKAQZZNMXURDJUESESL
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LRIVIADRFYAFTUNBXWTYQWMLQFMJRRJJDJVIDMXF RVGXNETHVKHTNIUXJFDSKKGPCUWNUQGENGPKHMXG ZLHNBLYGKPGIXQBSCNMDZINESUIBJHYXINHBDMVV YUXAPELXAZAUFKCLTYPSGKRENPHDUJSGBGZOHUET RXPOATBPHPGEJAUNXHBLWZFHVSDQGPVPDYSIAHEI WNYVAZOUQOSKAYDDMKGGSTDDTMWFRAZRXSIZDHXI ALHSQHBWZYCLDTEFQJFJLCNBUXWKVJDQROQVIRSG KTOJGUDHTVQMTKCHGNUSVAKCYXIZHMBUQXQECRNK SHBZZVACPYNXORPTPQYRYFCBNYKVGWRHJCKPXZZU NVITIKPKZAPUUPAZHYFDRNCPLWXOEZXMRMDSMMNA TBVKUMIDIGFQFOIWGUALUAIZRUTNXFKULRDRAMXB DMTDVCCGUZQRLBDGHBLRFUPKMEUIMZZCOJXFRGTJ HERTSCBQFKVLPZYHFMDVXTQKWNVFLXUEQMMVHCNT NAKFARUCTODGUIREURJQNVSULFKAAADPLTGVVCAN JJHJWOTIFZZRAJYQYLACZKHDSIUIDORGEHRHROZC AAUVSIDBZQCNJRUMGPEYWFIVFPVNBBMJFWYMNYDY YCYRKFXYDPNUGBEWQWBOVXGEUQRXZEFCCKHGKJHY WWKXUBOMXGVNPNVFTCVMNVVRTJBFNRAWUMLIAMEE JDIADRREGJSVVMMYVRIVEQONPBELQOAFPGRRMXGI RNXYXEMMPDPZTTOGTCAAKOJKGQZZMFCAGVCNULLX KIOLHPUNHJGSMVPHBIBWBHNKIXXVNUMDMNHNMADO IEUEORROVHWTKZRVHKAIBHEQGMEYUKGOQEWQEYGZ XEBHHCAKCRJCUMWQIEVKYPRCYRLLDTLECLYQUAJW ZSRUNJFPRCIEWOMBBXDTLJOFBYTHBUYCUZEPJGSK OGGLRDBLSDICQEPUFYXUKBCENWLGAGQZDBWACSQP KQXJNVWBMNONXWEQTNXACOVQDBCABHTWYEJJIGIG KVAWDAPEZHRDPPYHONWMCCDWCGFDVFRWNQFZSJAF TZMREONJJJQQUZMGHBQMSGBVRKEBMWPXWZSQUOMB IPBSYJPHWRWDMOTTFAWNIVLNEIMAIUYTXEOKQOTM QGTHTKDVHCYNOZKDTTOIHOHSGUINWYOUABYFAUCN IUQJHYUKCLGDHTTNFIFAWNPQLHGTKQDNGOPQHEKQ ZHHCUFIPAOKMDUHJRCAWOBYHJSKOGEDIHCJJHAWP WDYFZVIFXAOJYQEOTBYIVBRWWVQKFNHZXYZQSGGJ MQGLQWXGAFOZYDQDPUHAJSCIKSELFCJREPXYRAYS JQXRKPXVATWEAWFJTHUVMHBPJFPWLXMWXKVOIAUH PWDLPULWXCNHOIAZGHEALCCJHZTQMVAZVHJDUBFJ KFNFIFKFPPVZHODVURUSBMFGNPXAMUTTZVXXSKTF OADPQOEZYVEGQRRCCUKXIUBLOTIQWDKISJWEFAOF TGLKTTKEWRNJAAEFCOBCYSVKKTGONRGRXIDMTDKN KCRXQEEMKFXFRZRVWPVAZNBXHUOQNRDATEUXQLPM ROJJYFEGCXKJOVABOPLVYVIHSYQTEZKSSAWTPKGF OIPXPFTVZQWKZLFJUVAFJCQEUCVRNJHSKTYTHYKR JQCLATHYDGIRGSWXYJNAJEJKCMZLAIRQFTOTEIOP PQEDZFWFELDGTBNHYJFRUVEUPWHAIPXZQNPELJAL FFRTHSKXUFORWDMHGRUUCXXYCDJWJHDXYUBSNKAR ONYIAYKFOFTVUDNLYXIKIODBODRHFPMVWFTOYYPG ADTPFLKSSPGQVUOJVIBMLFWWXYWTXTGKFXCYMTHQ AOVEHWDFNHSMRTTSKDJJ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KOEXCXHPCWZCHXTGNQEWBHBZLLOGUGGLFHQSWCSH GODQUXIUHVBBDOJBKUALCGSXRHFWZZRMQHIXUFHI VKHRJJTJXPJZAKLIGQITQBWQKEPQKRDXRCCGHCVT RYHKLCAHBFDOEMSYQCRCIEDWWYSQCNQOBHXAQPCL SQFBLRPMJYRPYRKHAUIVAYUJDEWWOGDJTVDBLEFN OIHOCFYKFKFEWLCVHZFXKKRXPKQVGKPEFAZTXEKC BNDKFJYJKVISVAJFNDDIWYNYZIOVTTOZOSIMOSSR UTUVTPJUMVWYOIBSEZRSFOYPTJJWMWYSPNGSORTC PQBRBMUANPKHSQKDNBFEIMVUTSTPVKFROMCMJMYZ TTQKBYQHEPMBGCOHWNZDIEWRESHWDETHDICWSLHI MJZIXABJXFQQYJILZWNHRPBHIWHDHHDYFSJEYGUO ZWAIVYAMWQSNKBDGRRJZSUVXQVTWZXMRNJLGGTML ZEGYJXTAPQHMBABOUOAXUSYBTLOGROFIBXFLMGMM EMPIXXKMLIRMHGYXSYZNFMFCCTKTFUIPFLOMSCHE VHHGEFQEILABGBIDIZUOIXDQQWGNFAMKHGTJDBKC KLGWLPKZBQXSWVNRTMXDTLYOLGRKPUGGNWRPGLUM XQBGHZWESJWKCPOVHMLPMNQRRUHGNKDZDXTFSFKV MTAEUNIHGBXOEBHWWUJMPJNTJUTPAXCXOUVQTAIL ERYCRCARUAORYWMHFVZCBFVRYCZLSHJSHXHJUTFP SEXEPTLLNRIXIHNCHMTHZFEBTJLGEFLVUNDILSKV OPVNNLUWFNVMYSJKGFHWGWGIBLXAFVLTOGXAIPQU YCVJBPYBVCZFONLZQQSWOMCNZWHMFBLLMJXLRSHU RCGOMVMBXCBKFTMXIQVWBLGRHKQEVOVDYJXAOBZA JTYDRIYSFGQYANKBCTJMTNYQIBHVJMTXJCDIZSZB FHZRRIVABQCUVJHAJIYZRVRJLFFZJPLGSCIWTJPH YWAUZCQNRYIKECJWWSAWHKJXHOEBXSHNRFKEGVAC RKGJCFQKBHZUAPNXAVVVGJYUXYXTKBJLFVAZQHAA SUJNBNQMWTWATWVCFJHIMLPPQLIWZCHCJLBVTIXU VMXMFXVVVIQAXAIPTNYLYVCUXHFVWXWJOQHVJTRM ISZGNLAAQUDUNBRNZVFLCMKCSBOPHIXVUDDMBUYG JWOYSWIPWUUAGEQSCZGVBLKMXYFMCVCENYKARJER AEMNWUYLFWHIMGFPTNTHFJZZUJWWSHFGKZHTRITX ENAIGFSBGPBMVKKAKBLERUAHHNNDVTBHVFBLZWGO BPEFGFSLSAKUUSYKDBXMCGQLZEBJKHGOZCJUHOEK QTMCJWVGKUQZKCGSKQPWZONPUJYSMZKBDFRTZOKX MDRQCNSGAOXPPWWDZNROUIFHJXIGILQRNUUYGQIN SNUYQVBRDNLURQSDDYCGIQLFRQAIJXOUWEBHKHHF DSMNXVMADDZKWWBETWKOJMKDZNNLFVUJAJGPTMYW BGOHTXMUFEYSXMNOEOZPBVUPPGWPEFTCQHJNALVY BOXZUMVZRFGWPRVHKYLWSVLFXVCRYZJWSWNMOKTZ WUONZRMTVOYGQEZTMIIMUOSCRTRYTWKLJFUBEAHB GCUMKGVRVWWWLBEVMCLDTQQZLYUUWYCHWYRTEDGD NUABIEUBAVRIQWRMJSMPIJVEFTWMPRKBCCQVVVMN OHIOLHFRDOLMMXVJZIQHNCAIFCXFMVUJAIXVTGVS FEPOSPFYGUHIRQKSBOASQNAPOMSJBDCVICEKYIBX LGIETSGEAXJFJJMSSKTQHVIDQWRRJXKIENRRYUFR MZBOTWKPDUEHGETFFAKADDUFFUHUGSIPKVYDSMIF AIIJRRHZXEJKYDICTTGW
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ODMYFJBHXONGFDBZOHCTZSHIVFOJWBVFWQNWSZIF CLBZLXZCFTWGTOOUBPCTMKUNSLAZKYBBBEIDSLAE KWPIFMAOCPEACBOQLNJGVHVYDMEMVJRTQUBKTFGG LWZBCKXMSRMJHOQRFEAYQIRLANLYUOJVGSMNTSPA XFXMVIVIAMPNFJRPYCKVSAIQETMESPPYQROKYYZN ZBLXTUWUUYWDKMHZREYBMLKZRYWIZUJWBQZSWPWE HCNVQHFHWZDOVUMBMUVIZDYEZJPVIEKZBMGNTJXM AGJKEFMTSMBYQCURHODWHCCOJOYUTPYOGKMZQFAZ WZLFEQIVNHKAUNIYJXHAANRCCXBFBXOXMENWLHQN NDFLBKGROBIOHJSEAMVSGNMOQEPVRYWIKUPICYFW WZZOGUWARZZGIKPUDRNEIMINFDPRPNYLPYMCXIEL XGHMBGRFWLYWUEBSHXUDIMBVIQKQUNBSDRXVZLVB HCWWNUDVDHHTFZQYIUYMXZFSFSOPHSFZUVOGPEVK DTIPWMYUJPRKZEOLICTTFBAYHITKNOOJTBOKYUBF SFVBHXSTDUOHIWNOOVLLRGGARHWQECXXEZAAGALO TECYJJFLKZZOWVYAAOFXAZAPPOVYUWJEHCBSUSSD LQFOTKMRIFOGPUCSHECZTXSECEOFIYQXUNWXKGPC SEDUQKIBKURVPYWOZUFRYUAWTANHRKTQKHFFYOVD IZFLBFYKZKYSVJSTIADPLGBIXTSGGCIXANPKBZWI OYLBOCZKLAYIERGTCARJQZNLDYUSYBOFQARTZHQU AESGPAOFHZIPZZYUKIYSTVDTCVKPBNNNEIASQYJB WPAAVDABGMWTXLJBTAUDAMOJVQFLYTMYBJOIUWRN HNIITQGDIYZCZQUELPXJHCMOKACWQKUITSRLRWIG IXEJDSUDNRPNXQIXCNINDWDIVDKBMCCOQQGZIATP XACXWRFJEQURUUBXFDZLZAXJCHFFUDRUBPHSOGDZ BKUSOBFGITXFXESJAAABZABGPBPUHIJBKCATBIPI QCPUSRPIIRNITEJZNEMQTKLJHEBWMWLTMUPIPEIJ HCIZTCZSNTKFFIAZIAVZNKLVKYJBTHQYWMDGICOK JOIBNPYFNZVJJCTMILXBBRLABUJMQIKUNWAGOXGX TJHMBNMXYEQCMFFCRLQMLNNWVTPOZAELWOTVVYTK UWJUCRUETLWYCJOFYICFHDONHQWZXWKQWYBSHFEL THIBSPBFTHJEDVREITAVHERIXQCTMQTWJIRIKTPA VXTVKXBOYOAHYYLXLIXUXRFKHEXTNNKWFWKXUYMW QSNGSTEFZGZISMJXHCXAAMHRTXNJSUZGYQNNMFMJ LMLPCAHFANGBITHTAVYVEWIMIWQHNTNSUTPYHBKJ PPLTXIQEHCSGMGDWWWTKZLMWBXRQTQIACJDRJVXI FYYSVLPMMUAQUYZPYNGKBAKSEEKLQMWWUSKTFGHA WJDWCUYYXODLQTLCDQYWKSKGXZYILWHMYFTTDDPN IGZAPWYQFCRVCURPSQBGGEUBEWJSXTJHBWAGGCAP JPQYMTRUHCRWEBCHJQOQVSFDEZGJEQFQLISAHMZO CUATSUNXWKDKYPWVOQHHYYVYQUDSFOQRGMSHFJEZ HXLBQGUTYOFJRBNLGGKCZEMLLZGODWYYCUZUNITU NBJDNGIBVZBVEFYNREVMONHLDLZKXJQXCXFQADJS RBYNWUUFEOBVXTWQBBWEDNUMQCRMFFKIHFHNWRZX CXJRMUEPYEFKUBBVXMQLRMKDKVPYXMTSDLBATJOL MDGVODNZOBMRNVTHMFSNONGUSDJPZWBFAXAKGVUS LPWWCLURBTWLICYRHIDBXCWECZRLEAADTFGWOYCL GUPHAIKURCBOLFUHAAKR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      KLKNYEEPLPIRKKTDPKWTVVSZEHEHTUCCBWLIWFZZ DPFKJDUXDVZVEHMEDLYKISHPZXJBXQQGCBGUKURQ YKHCJWOOQSTWBLMUGSLJSNFZWRSFPIDOSQIRPIJU DTOPHTWVNWEZYCROIJKTSAYAVBPQBWYPANQERCYQ HEVBLIVVACQQNFXESDETGANHHKMSEHGENFSTWONL NUUUVHCLMDHILCVLSTVOKMTVGQBKTEOFQUJSHZHO THWWIYHIFBKRKOYQSNOGUEBGRLWSSUFIUNZMTLJV YRRJRDTQCYOAMCFJVIAREYKUTBTEKCCBBFNGLCAB LSEVULHSNSKAQYQEFEXISARADWDNCAAUKHGYGXTK KXTTQTWDQTNRVEAHKYGBBBOBEDLQEVPQYPWOIBVK EXBOTHMIKAIZVSVYBVILQXYTKTUNAGBFJOJLSXEK AAXVRDYERZFDGIBFYNEXSPHXVVLPTKRZXJVUNDAQ QXWXYATVSRSKHHWJXFKNBQCZAHTAWLANGIDHCDLK YMGCCQJISZSUZWAYDIGXLIJJWMSMKGPARQQDJBJA WBOKRKKTCEPOGKLJMTMVAPYUYNMMSOLBFQHIYDYA UCJFNXMIGGRDOIFLEQXWXQIRVNXCVYRDILHAOMUW DTZYJWJUUKGQVKWCNFDUQPHOOSQNQTDYYHLJIRZL RSQNQKSFBKWMVJLQLWVIRAPCAHZVLEFPIGDRDQCK WBQIEJZQRSJQENDVFBMTFEWUYBRJYWJFVNQUFJSA LUAAGJWSBBAPMUGJPLTFBVCMDFZAADQJKLXNFNFO XSATYJMVPGXPITEOSYNDAOLPJKACOJXPGIYPVVQA ZFFSZGZXIAKJISXANKMYWKLMDXFNJYWRIYVUAFQS ZSHIUUBGJRJSIZWKUGMFUSZTRBHSLXKJCPCQILNJ OBAQAIIVRPUWYZNLTRCMRRWBGUPLGSGBRBLFOEJV JKOCTEFUXWVTXQIEZMJMFUHKCICYGDVBKZSXTTSE HREKHAIARBTXAJZCZGAKOGLXZTERXAXLLTDBMYCY KTOXBRMSCCSVUHSICJTTQEVPKBFZNYFZYUNZTJJO HTKIFZKALIAIUAZSGEUXCCWELKXHQNXRTSQWBPXD KDAFXUILIHASZKWLVDMHBBDPCPYYBJYHNDJNQIMT AEMQQNOOFRJFIVWZEDXQZBEFGLTVDSGWKMHFTRUW TXXXEAEHPUIFIMXMJGDTWXUDIYKFFJWYHKNFQTCH ZBMYLGVJPRSVDKUCDGPVOTYMUXYTXHBUOFBTKJPM SRADCMUSYQHSGRHYYIFIVYCZHDPAERHDFYIAXSYO EPYYDLISXSIHHWVMLZWQJJTWYQODJPNWUHOUHZAG KEIAATSAZDMJQCGZJMWCCZVNELXIZIZDSPAUYVZR HJNQYHAXUOJCUOMFXIJMQHVPGMZIJIYBZUELMTHX YMBBZEOPGOGNKAYMKLOBRTWABNMCHUJQLNYNEOCT TBDNAADFGOGSPQZFOYFNIHBGOYNXCAPLKIFPTCFO DXEDLQCRNIIRFTPYGHFGWOLYWJUJYCLOPLIGEOBD VJQYPKDAQSNQSGWKVTJGXKTKKRFJWEZSYFJQZOBH BAZXTTQVGYDOMMQAUIGDZFWWZAMKWFEIUVLZTRDC GWEKLKGRCQFTYSKXMPIICCDNUFUBYPSSGBJCDVCL HXPEGSKVJRFEHAIGQMYRHOTIZUFXEGOFLWQZFIQP DTABTXSSJMKVHNYOQMKJGLSEWFBLVAPRYVEULZNZ WJYZOAFUAUSPFXYDGPKGKROOEBRTROJFZBVVJQHI HUPOGQJQYTCBFCJQJFHRBZNPKFXVMUASAZJTQEIU KFVBYXUWSQJYUTGXBMVOOZHUBUJGIXUVLPRUGPUL LHUWTHKNDERUASGAJYGZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      SCOBAKBBJFGAFHKRGOFCNVTJUEIXNRIBTGRELDDU WVMQLAZGLVUMCCQIGWOIQDPCUTAZNQYBCWITOUSN CIKITBTPWLQZLVUSLJFWIDAYRJSKRQZNAFFPTSQH WQIGJPKEVZFJCQNSORIRIIMQGSYXEWIADSRCFPEU RJBLLJWEFUGYHLYYHFPJKKNZOHUIZOKYMYYRQLXQ GSUOSLFNCLBVGETHWJEZQWUQRZMSZKLRPFGIVFZJ JOOJIANLUATZWHNLTKWBRRVWZJMFTXDQEEKMPEYJ YCFOYTFHOLSAOFCBWCRZWORDJNZFGCMNJYUFVPUC JXKGBGWNSVBNYNWZTTOSPDNTQWQXLNRVUHTEANTV IJIUOEDOOMPCKQUQZWCMFVGFTUPUUNKQADDVPVRU TQZTFFIZJQOWWEXQMZSJOFHNVZYEPQRNYMQGTJKT CJKUNYHJQHCHUUDWPIZVVUEMKUPFKYHHLAAWALSW AROHEFXHSMCCLAOSUTMGSWYTOZDOIESXKZIWWNRR TBROHGVKKXPZHYKUVLYVXBYZSPZLLMHGMLROAGFC XMGJWGMOBZYFXSVCELSWSLEPKADJDALSJYDJHTAO COPOXBVNYSCCBUCZWPGFOERDEETNSLABYRPBGUII ZRHAZNMQPNTRGFSELFLEBBTDTJDNIYCBBRRFMRZM GWADFKCCLLXXTTJLFSVORDBIUWAQJDNFARVOTPMK MJMKBGLVFLGPKYYITBONMQEGBKKBPKZIKKGYLJQI BCWQIMSMRTTXFGKDABXNKSAOPUWXJMGXKXDOCTHY YFJWRHVLIRRBYGTESVFEPJKQDHDLCOHUXMUYUQXV YIGGKQTIHGAZKXYDPGXOHWBACXPFFJEKTQQBJMWA AOCQNSYPBLZUAGVJSFYVWLCCWVINDIBIXFQMODML PHBDGXVFTLTBDBMGSIKQELAOPLAOKYLWGXMYLFMK UFVRCDPHASQDCDIPHFJOLJUTOMJCQAUHUOCRDUID MKTHGXONRFOOVJGTNRWSTLKYAMSENXLQZQGGXPGY ADDWHHMVFFKSUVBTWBRSPKWFZRRNOXVPPJUWNLYQ LIYRDTNJPTDJDFTQUAPFJJOWMUDIOVNNHAMOXBBY UOFMXJZPMAUZTNBRPTCAQMPYPTGZPABFQAXAFVVD HALLTVMHZVPMGVEZMKWGFNEKWCSPXZAXJJHQQMEI YMSSBQJJLHPDFMVIGUMTEGLVKWJLOODJKWNWTFCJ ISPJGJCFPTQZZONEJQKDOMOIHHXUERWORSPMLZMG QBNEVBRMOIWUDAQEGVTREUAJRRBCODRDDPKNZTNY AKDFPPQNUFHXAAYZRWDSFDPCVGIIJZGTZGFHBFRF SQVWNYIGJTLCZVCFVMAGYRXENQMKCCGNOVMILJYK ECZUAZDLTYDRYMVMIHSZSPQFTQEVZLGMLCZPYLIW SLSPXNLXSDXRGRKTOHELFNZRQJVBGRKAKIWZGOPW DZRFGTDVUXJVLGJRNIEBEPKRAXVIEZHYETVMGFCX WSRDPOEUNRIFGMHNIHHMEUYVAZWANFUJJRPMUANU TIVDSNBIXMQLOABXLWSLTUHCWXKNWZSQBHTAXVHP HHBVZNLAVRFRPYQPBDZXNJRXZUGXIWZSTMUFUQWQ QLZVRDNVLOILJYKYAQYMYBOTBPQIPYXYEFLPKAST AFXVBEZPAIPRMCNBMGGBLAJLOSDXSIWTZRETUNLV ISRKUPXZNNMDTTEIUJTZVVYTFXUQODOHGBIUPLYB AAQRYEKYABQQBSUVKJUVVGFOATKWLGAHGWOPCFHY PTDDCBBWIBIHTUZGPEOUKMTEXXZUMYQKOHNZEADF XNHKFWAZNGJOLJTZQYNMCJNBATMISTTRQGZBZXVW MUCXIQDDNCUWLHBANDUW
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QWGLISXGPDKHZFDZCBVOHAAUUNOYXQCNMQXIOWKO ZMHKPPQNFWGWJEOHOVYWCPUPPSDJREPLKCVOGDGX NWRQBXAXNRFNYYMIJIZCVQGSTQSNBKQMJGOSPANG TJYSNHEAGNAZTUHZYQHKGYEUEPDKFACYRSULRJYD TCHYVLDSGGXHRQJCGLSMZDLTGLWTIVQTQKQFPAZV BCMLINTXEQKBRWDTQQALBHYIEUWPSCWHWOMAPEBR HEVBZCRRIDUISJESGTKLSMWDDNWGLTEOURRBJIHB MKWQIBHATZQBVOGETLRMWFKTIEJTRXEDNFDWBPZA FTGILTUSPBGKKKZQNMWZUKDGHSKLENRJKFSDPYDS EBTKMVGZJEHASXDFCFFIYHBBOYICOIFDHYIYLQVO GMSLMXCKFWUHFIBDYODKWCGCLKFIXXPHAGAKDHGU BODBBRSMIPAXRZERYMMJJRGKVBJKQLUAOBPVSJJG BKQKZZVJFVKFTJBJCLQUDMDOQVXBVEKXFXTOZAUV XBDAKQOHKVYPIHNTFEGRYVAQOGPEMHDIOMXYYXRX ZTPNDKPWKKGZOXKXYQEWOABSBYVFQHTRDIMIKHLS EHIBNFVNQJTFSULNNOWKOGXUFXPSTTCYCPUHTHFB UCUJITOBTMZGPFAYTHERETVRLVEHSZAMFISOOBXJ CCNSITZOMPRZAFCLZUIWFFHEKKCUQIIVNTSXVHUG KDVVZRFQQAOSVSHZEFYGLTHSVGZHRZVEJYUIFZXK HLDMQBTQYMOADOCSRBMVGGHYHDWIXUWLGENHOEWT CYORDZRJKBUPXEECYZLOWKGMEULTEXORDUERZMKL NQQRHQXOUZVSWQHFDVKLLWMJLLNENYPVNZFDQWBP JKYNBZKXCPHRFTSWPWUGVMSEPLCGRERVPTQZPQGT SBPSFFHUXMDEMULTSTGOINPTLEIBCZNRVQDIYVJJ RVYGUEVIKNFNEWROKNFDTYJGZCUSERGMIEFWFAOB RINTNIUJADSBKZQHZOGGEHRSTQOOBBPUOWKNMVNM OKUXFYVUKMVFFBDZUAVJMQJACNIZLMNMEDXZABOQ AYQVCZWCRBOMVCYMZPSLJVQLFNKILJDQNTGRILUX QBTWBBKSVGDSGSVYOCTQACLCYPLHISVHPZVRGEDS IDYVSQVWDEBHBFCDDURRMTKDMOSIIGGAICBOGNBP QDOKXQBTITYDBAKVNELJNWVQETMFPCLZDUWENFLH THGQCDEQZHCPDRWIDDENKFEXUWMZJHGCAVFGTIQJ KTHTCTGBFKHEKJQDKGJDCREUOWOVYLVCOTHNLEJQ BQFENQEJIFHKQCXKVLCDTACEPKJJABQZMUDQOTIV BNHDWJAKZCAEUDTNVUVOUTASBKRLTRQSJTHYOMSJ OFXTVPIZTLZMHLKWAQBWXJDPGRPKLGLIBXAZSULI OWIYYHFIGUFBIKHRJGGPYNOIGBXULQYGZAKDKAQZ XSVGLBQCGBEWVPGANMXOFQUFHLVGFYEPABNWXSIW XUZROHIAKHIUOZKBWXTCQADECUGAAXMERHFQOKEG QSTFUYDIAYMUXXDLIZDGRXYBJEHLUHUXCMZYZNAX VBFTSGKGCCUNNEYZSCCCJFYWZXIHPGXFOUMQNGZV EYFKZGQKXPDPWXJUDNZCCAPOLEUIYVPAPBJPSPOX PRFRWMZIRXHWUCSPOSOZDWNBBSZBCQHRHBEQIYKU KFHEBXGJCIBVCROBJRAHILSGKDGNQQIECRZIFHVD MJRUEGLQMHGQHZOBXMHKCMRFHIJDMKOQOMHKCYFY RNYILPWBIQSQINMBEHRRWENKDFYEJFYGZTZKGZLI CXPVGZCPREWJTUEYXFKDTSWIBMPSZRISHPBNBRGQ CYMEXKCMCVHRGVEOSRZM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OZUHFSTNJKJFDSIPPMOCEGMRYWOQTWDTUJLCKWPK QHPNDKMFYDUDCGOQOOBTFJXPXKUBBDNDPUFEZSDZ MFCIODQIKWCFOKXZXAZPSKNAYATAHSTTVBLTIYQS AUIRLXVREZHHSJQRNOXIDZRVXMUXECUKCPKJMIST TSKQUFVHNJMTVBXNCQJECWVVIOUIKMHDSZUZNEAE QGUGUWSLYLDPGUFJJKKWOKIGISNHLCDJQBZYAPXP WUEHHIESZIJELJOKWIFOXDVMNCWTRZHSCNYLEPSF VDIPSPCNKYIWWISDNHYNFPXBXAGSJJUGCXTOFOGW JIIUTRLMKBCBTIHDYLWXMGIELTUSXMSNJPXFLPKN YNYSCMFOBSCARTFYBMUDWPEVYKMONWARNFCWMBOX FHTIQAAOXDOQVDQGLGCWCIOZNKBJOHDOIHFIWLJY VUWSIDFWVTSXIPGEOLYRIKTBSFODUEGVSAWBGSAH RRNENUOBKAVXOYSKIRHKHKDDBSQSBSPYWMGUOOVI VUPLRDMFZLHJIHJGGWSZUDOWYWMCQCDHPWUEEVEV CWKQBRINVWLWIABTUYYJCKAOHVXYJYPMPCDPIIRA SEAYFIQZTUIRUVZGSBROZMMNJWIYHLPABTMOGQML IXMCDPWGIKAUKBLYQPLKKSIZANQBDGZWAJOXRUBG JFPKGXQQODXDDIKBUZROKTCXROKGEFBPRSECGHYA IFYDQXWHSHZJRKYJRXMBFCRNVCVISNYIKFFEKUUA HIQENZDFTXHZSTUEXSPDFTSPYRPRSVYHNNCQTJPA GKEHXWXNUUJBNRUSMKSIZNOBUBDHIAVJZGNXXZBP EYGFSCFXJDBCAAGFXMLRSACFMVGSUBOMUNNJNGMZ PAHJAYJZVWZURBWCMHUMZWWPAWCAEFQMSGFENSNB FILYGQCMPVWCVUYEVITSJHYHETRLLIJBBJEJGOKV AVBTSATMNFLLOHWVJQAEIQIHMDNXLNHEUFZJTAPD HFXGFZEYTCLEKNRUQARNADJEGGDWFXYMWHJLRYNN SSMOOTKNEXJUCQFVAFPFVROOMDFLFLXOSYIUGBZN DQKONVZEZGARYXUSZYIBSGEFGWLBQTIIAAHNOVXW FHMDEFSSCCUVRLERXLJXRABMSHPNTRVWOHEZITRG OFEWDALJTAGIZDLTUKQVLHXQYVREFZYGZHXFIMUF AQPDONJVTVASIBEVWRGBIBGKLXAFCTMYUDGRUCUT VWSKEQVAJFYEHHEGYZUJRVRUAMVCLEKFWZNTAYQJ DGYALPIFLXFAZGJPSIMABLHTOODYPWUTINBWADEZ NEFIBAVXGYCCBZVKHICDKSFTKHEBGWLURMWEKZMC LAJFLBBXMWZHIDNQJLTGVXPNWPEHUWKOYBOFWZJR IBRZOUFSTZSVHIKCIFGAKMOHWAXDIBFLDBXLZHQE UCHWMTVTSFEITHGNXXKXQBVMKIYBGOQMOABWVODO LLBWZCHUFCSYEAUBMBPPTZCWBOCFCCYILQKNFCQZ NBUQCVGDGWZXURBJUUDMJGMYAEXZWVDUCKNXDKWU KUVHRCMOESNPJNSMUJYWLLEXNUGBGSAYNXXRECAL BEZUOVPHETZHHBMJAGSBLELLJXEYTIQZXPCTCYPC JNACXCRVFHQNBRKBPYGMKTGUUPMDXETEGQPZBZOQ ZGVNLXQCIHZXPQURICKNXRSWTXVKTZYLJQYONZHA NTJLFWONVMUIWOBCGYYUCYIRFRQBFNRCOSDTQMHB TAHSSSNWDVFFOHBMGOFGXHIGWUAMRXRGIVTUGRYF XTTRKQBYKGBRDIRJKAFSTDJQBCXDHWLNGOVXJMHC HFQLZFKBBEVFFQRGATFMYZCZWGVVURHMNKIPXLMD ECVDBOAXFGNFGIPMJBJR
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      IEYJSHIGQSVYCSPJOVBVUBJSBIISXMSLVDKAGFCG AIGXUZJOPYHQQUVDHOZPOCFBWPACWYTZTIYRJYWS JLAFFELYDVMMBDDRPEUZKSNHHCXJKYMVFGWWQQKK TDELOLJSFQFWMSRJAVYCKMKASHUZSMUUQCGJWOYF PCHCLTYKIPUJQLDLZADFWSEIPYWHWQOQMSGBHBZJ HFGHBIBILXTHEIVMYJSHMAJRQRTGSMEKFDLPGHMB XFJJNMXKBLEVHFRSHHZKWRCPJGHHBGGZFSJXYINC DGEBXDWXBGGHRKCRZOARSCUTDRPJGXCMTRNGNINW INOLTBIRSZQFJOSANTEZBIQADYMOHFCFBEMKRXUO CEDZJUWNVXCLJQLWCGRCVHWFVYOHLWJIDZCIAXCS KFMMGEAANQKBICKGMOOFSGRGKLKIUBKJORXGAWKQ YYHVJONTLEKHYBNPOAPFBPKUPVGCNEGJBINYYOJN PIQNESRAFBWNDBCBKTPTQHQOTRSCEKWSGBKVWUZU UYGNYYXNBASUKBEWWIHIOOUXBGFUASXYDVSTBHGE WOVTRSKSTQOKZBJAQQWTADXTETQWLMEQOZBWLYXT QWSGCRRNNTGZYBSONQFOJHAZXWGGZGVSLYOFSEWA SAWICJYQAYUJGBVTTYSZMBPDVXRVPRXACQLRTKFA AGJFBCWJJCAIGOFYBRLSRIHFRDZDZEOKQIHSGKBD YALHISDYYHZBTMNRAGTZHJCIXETJUNKLBJIPBTZO DLTXSGCWEDJXIAJDLGKKWUEUSPFQWWNELGCMCTDC YSIQJDHBAZGJDCNORNULIPDZVCLLHPWSKKBYFOKP MASUFQPNVVTCDETVRXNRVGHJACTJLXKSMMIBPLGW NTXPGKPEGRUPGJQSOXPYFDUNSKLQJRZCFZSKUVPL PJXAPUHCKFYMSDWRHQXWWAXSAZXQFOWIBLTVGBFG OCFICXYCOJCQZUOXXHRDJMYSQPTEBWAMLDFRQNMY QJKFKSWQSOGRIRBCDKZOBTAHRDJFMLKXXIQYRPBT SWVYLSMDCEEXGVIACHXEPJIHESBJJGOVFVEGRSTC YICRJTKRZPGBVTLXQBZYJUMQCZCVNBCINLVNYJWP RJAJEFCRASVQTVFLZSLHWLFMVLFRIFNXHWQCATNB KAPGIZZHCEGMQXXAYWIKXJRBFYNUKCQTISIMYFYO IMPXAFULKOTHCCOUKQTSLYEYGOYPNETLOARREIVO WBVSKNTUGZREPIAZLZNBBPXVNIQMLTAAKJFJJAII IIXRTVIDSLLUECSJYISKAMVZCBQFWCMPIORFKKZS KTFUVLHLWIHUOFVRKRWNUAAZTDNVWAUXAYNLKWXX VQJSURGUQBTZZEONRNDBBGPZFLFHEWCZHQXMILHF UDBWPRXEOBEPCENSWPNTLFUTHRYKSBLGLSHAXUCV ULISVDYKDHFELJQCVAGYZNOZKJWPEJSUSWBFMWHN DTYVPPPSLHLZJECCOUMUVOXWVNMVJZODMPBHHWYO YCDVREAKCHIJUGDORQESXXJXINVLPLCHZMQMMKXD XYSIDGZFKAANAHJKDDRBEHHYVLXAZMTYQTPYNGXL AEGVPTZKOKBZEFKGZFEJYLYWICEHIEQRIGVDTPXA YUDGURITJXXMTQULLSWXMRERXLWUHEWDNZLRBPNW KDYGARNDUCACTZEJAXEUZELEGUSAQWKYFOMYZHWD HXYWGBZLARECHMDGTKJGNWNSMSEKMAURPSNOFFKA DANKMRZLSLWHFSCOZCILSQJKOFBCUPHDBFNGSISS AXMAQAMOFYJMFHVHBMPSVEZWUOGNXCSECAGHQDXZ ICLISHZQNHCBOJDCLWTTYOZUEGPSIZOPKBZKATSB VMNFLHZEGNSGDIJHZLMN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OKKKAERYZEPPDMBCGFGWPQWTEGPLYLCFQGIFPDEO ORPTUHYFBUAOCWFQYSWROWEDBVWIYUWGNXZHLVDY DBMPZMELOCVTDZDIJKXIAQGPFNXPZKANMLBUXGHB VGZWXCNAGYKKVOHMNFPFAXIFTAVGRJBHOMDABTSZ LAGMAWVWTTSTMIYJOSFTTDTXYLJHCRPRPLTSOITA YPGNOCPDITOBRCNPQTPXSTMPZDOXMMYTCPXDZLTS OLYHIVRYNTWQIDZEKJGJCMTNJPZFYJCTRXLAKLNQ XVEDXPRIUDBOLHGFBOZSBYUOEKHHNACZZGPDQOZZ TQIYWWJIITWWMHAVLCCBQDBIVXRJIXHANRZIVOJQ JMGCPLUIWYDJYKNHFYGBVCPJZVDAFXJBGNDFVKGU WRTZVPLMQLOAVAKFKJCSBBSEWRVTJPPPYSGAKIUR DYMLVDLYAJFOBMCNPGGWLYSVPKCENYLKUUUISCTB VSPKBJGZCHUITBRXRUBTJLANDMNMJEFWIJHYLXXR FJAOXWQINXRROESKHJTXXCBCDQUGYWVYSWSMDSIX RKAXRPATMHTOMEJGDESGJIZALHXMYGNTKYFSIXQV SUHWWPGCCUBRSGCNJSXGUAFOIAPNBJCQOYWCBKRH HBGGUAZWOMQAWGKCIRVHBILAOYVUEKALZKMAURUT DNGZTEHXMGUWYIKOHYCESVHMZJMMGKPCSBWETTZC RBBLLKSZWVXHDPLAQJIENCTMPZXBXSIOCPGNXNVA LWFTLQMECPKCVGRUZLFIQEOTNORZOYQBBPIJRZVR KBKISLHUYYJYHOXZEFUCTFJUTBGXZWSSUJVCSDCI FEJXTSLBZHEOUMZTRQAIFNZQWRRQFYZCOHAUZEMB BMFRAMETVFDJWDSKKLQINVCSTLWABCSLSJOZRJDH AMBJTWHTMYIAANZLVDFVUFXRJKKDCDTREQRJMCLU SBSHWTAKWRYRRAUUWXTCTRUJYRLEQSXIAPETXXFG YRBHVYKNTAJCENWSHGZVEALWFQCVMJYBQXLVQDEC JCQVCWKMUFRGFXUAVLDURNJRQZNOSUNXXELGBJRR CPDJHATJLTZUMVOFMAXMRELDIQHVVIDQYALYZMXJ TWEWUSIVBLZBQLDBYTYEOBPDWZLSLNFHTDRLCRAR DBCNADWJCGEQOATFNXXAQAEABVMJGDIRQGZVKONW PFATHEIZOSSRLHCMVYPVQGVWMSJQPLHWITHLGGEM BPUQFBHUSZMRKMDVDTCYBCWXQVXPBPODSXJSEETG RPKTVNZRPPMSZCWQXLJCQXGTDTQAWPKSEMYCIAXD VYDVMCUDEXEYUUTVADUDISFRRIOTSAIXIXVLYORS ILGVFAXKUCOLMVWRFSDPAMZDQDKKTDIMONIIKJDS MHNRFTFNIPAGYOPTAKSNTGBVRQOKTKSIQKZLWOXP UBCVLDOGKLNJYSTDUWVLJBIDFTQQKMDNVIQWSAEQ RRHWXMXNXOSXGBEQFUXXNEISDGLRQSFWELRJEATP GJQVVZIDKEIFEBLDMAIWGDNWIFFDQAMJQSONLCRX QTOVGAQDNBVTPKDTHEEDSIIEDLXHGBUTGHTKBMWS JPRDZZXEJJEBXTVSFVSXJYYSQEDINQCNDLFOUFAE GIMBIBIDXPOPBIHWHFTWUVCUVQBKFBDHTJOAKOLF RAIUBQQRZIDKQHCVYBVOOVZBLKILFXPMMYBHRIPP ZBEKQTMYINQPQQXKSZBFTKTMHVPGSMLFGZXXAVLP LYMNBDDPFXFDPXRYAVHTLARTDXIKRVWGHEQQAIKI NHBDFBGKDYHVYWHMIMVRZJAZYNUGCHDXNSDAYTLT DBFKLWKPUGMJYQQUBVAVEDTQSNJDRDTYHUGKJFGC AQGXUCWTCKMOWMNNQQKZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ZKCBJZUXOXFBMKYRZKIVVTVMZWDVLYNMOFUSQDYD LPHKORDNKCCNICFOWGSBSOGPCOLZLVUXFOZJESCV JBJSIVAUFECMVUGIUGAICYLYSIZEGIFCSIKYJIKT YCDNPAQTLELUUMFURMPMJBKKAVPVXGOTHFRMNUFM WKMBVFBMZQUNLEWREUHAUHJRBIADGBRBYKKJBYFG NYWQYLWZLHHXWTNZNERFMSVLSVGVCDLNMRFSEZBT PACLVPPZBQNZGTZFXFLBLRULLUEAQINCUDNSRFLH FPFPPLASDKIXZUTHPEBRYIBZYKWUNLVHBGELDUCM AMLGFKEDBGSQBWSECEVJOLYHLDQXYCSQNJXVURGC IYGHKRUDKTVMIBWVPRDPCVWNHTDCEZIEFYJPVDHV LEIYQJVPQMNEYDABQFTPDYQIIEFFVIESVEHDODIY XMQRQUFLUPCBJPHZUUMVTGXJAUZCKZCFPSJEOPKQ KVYENORENMTJWJPNQJMFVESJCGGSCUKGOHWPKDUZ MQFABFMWLUZLHBTLODUUFQFNKRZXJUIQJBCXJTSF CWFFSXBIPVVWWSCHHZMRUCOWNFRCUGKSLDTFSOEL KYJLYCHTEGPVTVHGAYJYLXMNJCBRLAAXKNYKOIHY NQAYAMMGLVSPFNOJMUHQJIMFHZZUROXQLULIGHQL BGMBKEHZXKGKIIKUJNMFSDESANEKWCCEDNUSJGQC BMHNBFSDCOTDWFZOPIVUZPOXFVAZGGRFEKVOWQUQ GFGAVIPYGEAVMTZTSTSGCHKTGXVTUQVBARSOHFBX YDNNXZHFDOIXMJNVPBUMISYYTRLABVFVSEYDJIKE GEHHFQLUNNGBXQFHGMECGKZKFBFMQMSFDSRHVHLG ZHXNKQZZWUEWKEKFQONISRQDODBSNUMYMMNCGESV OBSQZCGXVRYXYJXFUHTNJFXWKRVNCZYOUJRITBKO ITPSOHWYPFEOZQUEUEKCWREXXUJQIXFQUQSKXMDH AXPQMKRSTCBAYKWYSRSPYVRHBGDXGSRJOPDMUJKF HMYZHRWCDHFPAGPYERWRADVNJPJNVVXJQZQPBTQY ZYNAPOFEIRYOWQPOEPLZPPWKFXYKJLJSTXTVHLOA EUJKHRGYKYZXGSQPGPTPESMWHAHEBDVYIRJHSBDP MNHCMPDSKRNDQXJAPBURUFZKDLKQEXCUPIGNDHXF VTKFJNELGTFFWULHLLCKYOBPPPUMYPJXZKCCVFHD TZRPNSLQRSICHHOORJXXWBNKXGWJSFYGSKEEATYB ATAAHOVHTBAXTHBQTATOQZIPRNJEWDNZKSEKMPLQ ONCGNMTMZPHHXOESXAIZTUDARAEOGYMSMHBEKWXE PPIQDBSUJHQWNONEJKFZSBYIZCDOMQHTUVDRJNUK GRTNUPFRIEVYBHOLJNQZYAJNCDERQAVUVTYNXXMK FPISTBABHMWKPPVFRKTJMKEAXYZEKJKOAOFRTFGU AOVGNENKURHZYQRCJITQXMHCKJOZTWWMUKTAGAZT VTXVQRENCNUOGZAXGLBBIVGLNSRANSSJCOCIWUBR XMHAAQMPUVILCRILWDEXANVJKVTSLTDRAQVAAKMU SUUQALUHECORIXMHFLBOZVKWTKYMQBGNIITVXDIZ FBUYUUBWRLGYJYZDHPTCUHAMRTSOEHKVYWVUYKLS DRJWWKSFMKWFLTZTCGLGPDWUXHUTLNMLAPKHPFEJ PSSBGSWLFDWKFAWDUBUDJWBMONZKORCGDNNGQDMF IFDABSJPCJLHHMKLKIVWQSZGCGWUWDLWWVOIEEHT CGHMWNAHAVYVNOLNIHYWXWZFZGPEVPKBBLVNTRKU AQRBENCSFONYAMXDZYKMIKOSBCAEXBCLGLHXYHOT WHJXBKPKAPZHCBLLTCLO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FFBXRUBDUOEZKFTCJUMACNUIRCHKTJGPWNDKGNGR LJYDBWHAXNQNVYMHDWVYWWYAAEBBMWOFACATRRLU DEUUKJHOJCRHPZKZDZLRIFCRXPMKIKJOERZYLHET MNNFINVSSTNZSGRMKWQFGHGGUFLFEXOYCWSPOIXT RZJAJGKWZZZLZXEHOJBLAEEMJBUQUAMPFXYPKJTT VJNJLDQEGTLIBYWNUMGOLIDYXEMGPIBWBSDMGIOG GVJCYHIWCUFKUFDJNNAHESFTHKWYTHWNNUUCYBYN VOEGRIFBOTQEORGBHZLXOLWSITALTGSNKHTIMAWU MRZODEFWMBMFRWUMWICHPLZSXCRWSOZMWZYSGBHP AMMFDETOTAFWWYEAQQWEGTMRUICNRFRQBELWTPWE KNNIVHELMMMIUECKZDMVWPNLOEZBMSACVUTXDGMR JWGHZBZHELIJHKEGUPXNGLPRZIIWWIPQXMMQSPJT LNFOHJYSDVRPNCNTCOBODMTYVVSZDECOUVWPJRFR JWFJKFDCVCPKUUROTCFIHVXZTXWXWZNWKXZYTFGB WFGZPGCUSEMJJCEKWMNDRXZWECMJXMIPSLPDLGAC JIFVUNYRFBLSLOATTORSEULCFYMYHLPXUHKFZKMA ZSMEMFJEYSMZNQVFNNWXMMWNWIOSANNVMIWQGNMQ QNRWYKASMCMVEAXVBMDSNMZLQGGGJYPZDZQKEWJV EYCBLTNOBKUOTDMDWRJQUBAWMQKZQZQZQIGKHZWN JRTHAROEJYSPEIICTREZHMMSGWKCRKXZEYEIHUXS YDTBNPPCRORPFXVNUXTLSGFHARDLAVBLRQWDQHGP QHZNMBEBVLVGUTTGWCNOVJCGDGQMORJOBSLGKSGV DUISEQAPSXYDNZPKZGCKPZCDWEZIUNULJDUCDMZY LVGRDTNBXJFGLEFPVRPWCWDBXGBREORXTNAIQKOI TIWHOLBNHUKKHNODFQSZRRPAERVSQDPQSUBWRHHG XQNAUFJGNYRXEVBNXLHTJDSOJKYNHMRBPBGEZKAQ VVZQFCYALHPDXPFRRKSUJEYRGDWWZDGQGMAEVEDI NBMSFIZQETFMCHALTVPKLZKOVHDSDNWHGYRDCNFX TUAMGADOHAGGQSRQZEMCWPASVXMCAEMDBHZWCRPL RFXSXBXSIFZLOOEJIJDQPXGJFQZOQRATJBAMTSEP QZZDUWUMHVIMGKXQWCGJXRUXYULDJPQAGQXRWBCD ACFWBQAYZYHAPAGEFEOCTDMVXXEQOGDJXZFXAIJA DERRXWLIMVBJZPNUCPRAKSHLQLXNRZSCILIGGEPR OWEGLTBTCXZRPUDAQYQTISSREIPUWQUZGMOQLMWA WRPMXVOFXQUFBROJIXQDATNCKJPUWYFUQBJIXMSW XGPXBLZTSDHFRNSDNRLXOTNIPDMCHRYVXHINABUA ZYELQEFDHBGLJLRHJBVFXMOYCLOWSCMDXTMYAOMZ UCCMHJVDPDEIPBRLYTXFZBECWBPOZXWWNNVIWCAK INCACOJYTQJADRXAIGCMFYGCQGIEBITEMLKRNLND BEUYWBFGARAWQOWPYNKSXBJFGHJQHHPQDFZZXDKI IXRZQQUGEGTCHIBUSVMQLTCOIRYABMRCXJGKEEAL FAMBINDOOROJORYBKGKEBXUHAJLJOQQWKOIDMONM DFXPXTPNXKATGRFZUIWDKHGCSSLKMBOIXNVPLYDK KNIQEXECUQDPVSDZMMHGBTOARGIVSQLJHWERZNZR CIHMSFMAJNKWUYKUZUCVHIFRHWSAUQYSIAUOZORN BAJEVPRBHYYEWRJINNSQOUOBFGFAXFLZIYAJETTH IRMAPVBQPZLPZVZUFNEAAMESNSUPYTWKUPMPGFYD JIKYPDWBFHAILXDOYHTY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      AACWEVGJDPGLNZWFVUZPCERTIGDPHYKFNBLJLENC WPAMJORNJLPJHUOPKYNRMUOMKBUAQGFPIHERJBOU CTJFIGYDYXVVSNNQUIBRSOFGQEBXUFIWRZMYAMDL RQADFZHFVEYRHWAGZRUDGOFNNIIXYMPAPGVPUZHY BVISAXPYUVTNKONOTVRAWIKUAGVSSXBIPHTMDNZO EHWAHEGNHUOZNIBIRJCQKNJOOFTQUJWQYPLSRYUA DIPKHCQCTYJRKKXFNWULQKSVFWIUSXBNYJSSQHPK FBNWAPQMHPULBMTKKRYUUTHWQSHCCQRTFDFWCMYV PBRUXVGLPIBCAAJJIFZYBUHQAOPVHVEBAICBDBVM SPBXTNNDSRIFROCGFRIUZYXKPKCEGXKCQCVNJCOE SBUBQIEQGWCHOONMSJVJBLJIFPVMIHKUHWNJZYFR TEMKXEMVLSNZNZKMGWQKULNFODPOQKFIKSEIQKYU RORIBOOLAOTHNADOEYHHXEAWBFAPUALEVTIEWWJF ZDVNEXEZKMHQPAJVLZRKNKINEKQWZZUWAGWBJAGK MIOPEQGMTMEDVFCOGPELZFMFGOFNLWVHJEZYSHPQ YWEQNGIDCKPXHHDMJBMVBEGCBCYAQYGUTDETUMUE ZXNQWVTNXIRUWEGTPKGTXEJCEEHHSFUCKNLLEBMB DBLORZJOYKMSJIDVBIHRDHGJBTACQSKTAEDHHFMQ XPGMVYEJKRTRCRJUFFNGAPALOFIVZELTDRQORVZK UJWAHPXBPCNTPIDNBNAILRAFBREDHJQRYJHLNGLP FDHJQJKSCURMYWIOTCEBYUQZAHXNQIPZOZZHBIIK HIFIQZFJVCADPLUEMGQNZQADRPGNEKUALZPIXVEA ZLKWKEQDAVEVUWJECILTXEFSBQHDMFKJZQZEDHZG VKMHYGKETOVJMEPCTURAVWZMSOFEGZJCQHABOXZN JSSDEOLOOJUIPWJVAENTIMCRDPSKHMMRTAFWIRDI YACCAPLLWMRDVSOSRIHBRMHAXUHDLSGOGCWWQCWT AKJRDRCFIEVUVHKZYRUVFHFRPQLZCBSFHGEIPLME XJBVDXIDPXKCMPHFQKKEJLVMWGUOLDTWQGLUUTGR DYNUMXMLWLQSNCNVHCUNNHAFJXOUTSMFAFPWMRIU LMGLHILBFFOGHWMTQNLGCZISNEPKIZADKPUDTHAM GMRWELJEMKRKQZUCHRMTJZYANZIVTHONCRMCLCWE VSTLWSXNRYMPATOZDZDPGIKBREVMLVAASCSONYOC IVVKLJXVACVNTRHBCXWMXUBTLBXYIXZNVJHAKNJU FKSXQMBCRXTRLOKYIBXBMOBEDYZGTXLRVTQSLNYX VHCNUYIUTUOETSHZNGDVARVJBMPKFEVCROGGCOVX EFIPVJWKFKFPCWERXCVIKGLEDZTWRJHARQCSOCTZ JUPHKPXEHXAVQJGYLLCLSJOUJCPSDBEHJIHXNQYB CPFMLEJRPCVDZGMUGYYFYEJJZYZVAXMFKDFXEQAZ HQENMNOAFPOBCMJDBBKRIKYILFFVDLWDJAJHDUNC PGVOIKNVSFYKJICQWBBIEIUUZQJAKMKPGFKQPERY ERVLGRPFVXGFFQWMEEKPNDIPHKFLAHTCEJVQTLLT QKJFTLWZBILCUEBXIYDOVKTSFWZARXNTIRZINZNK RDCNBQGGBJHYVSVSJKZIATVYJTCZDIWPXCVZIMXS FMSBZTAPTRAGPRWBJPVEZSWXUBCGNWFIVUFQVPNG ARLKPDPMMIEIXEOPIETHFRPSXPCASNOZUYNQUHST VJNYGPTNPYBTGQOLLTSKQPCUZQFEBWFFOIVLUZAF SCXLLCDZDCNKMBVXHUZUGBZFJRQFOGBXAXJDQXLF AOUCQFFVYLPTPVLNYMSM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LQTOGRGWMRBPTWDTMVCKEPIHDCSTXIJFRQNRWQOH ANQPQJJXMAANPVNRJDJNNCAGYGHYHIPHDPOWFAHQ BPNHQRUGALVVQMUXAOMFFUNBPXMSEHHQGEIZJNFK QQJLWBSPGHIWMRJCVCGNPPRJWHLPKLYOTYDJOUWN OAUCAAJQWVTANLPTUITNMMQXTYSYLKYNZGINCMTM OLFYUIPMUJRSENSKEVRNFMXDRSBRHQKPTOHLQUKN HNBGUXFSVRTUBFLJVSZDWOCUZWIJYFANERMZISNH IMJUYYTSSTJEPGTSYJMBNRKJCGKWACGOZMNMQOJB OGJNPQQCLGXJRXTZAFCPJADBBHLKLUESCAIBXPHJ MOWOJPSGIEQTPBUVXYZICHAIYUMOVFHWHOEIZVGD XGEPFVQWLFPDEOGXLITUDJIPIMDEHNWWZSGBVHWL TSVUEWDCUDIHIZMNFAPWSJMRWXOSKVNWQYEFSQUM CCCVMWDUDEKMWAJYKXJEIOEGPNDGMRBAGYBORLOG PKRMGWIVUFKXQNIBAIBZADWJDRWDLOMLHKUEVYDI WTXAPIGKVVPBSAHIKBSSNUHDLINJIXIEHAJDPUOR BGLEOFLWPXVLWNHKUTRQDECQTDTYKJLYRLTLUXGH TPWWGUSAHBEUKRTVCLPLPAPWLWQENEAJMXZLMQUH LYQFVWTZAHJHHIYMEPJXAXNYYWCACAUKFYFOTWIC ZIAJGFWVPTRDJLRCFTHNWRLEWRGHQPZASZJHSSGN JAXYZXPPYAODGKNYJWGMOQDRWWJISVOIBCOVKQQW RADQJIQXJLYOQOMCLFQLMMHAGWGZQUZAIRWUTAQV JAWZRAWGKUHROOKQOCCNTSCYGRERHRAXWMEHUUYS IZZSUZMDNUMNFWJYEQSYPRYKWLJFNSSGJTYDZQEG AAWXWHXZAIZDDTVTQLQVIGASIYKYRQGEAZQGCDGP ZPRBYYQYEUPQZNCPKSRSQKLWIYXMCWQWOYBPRYKQ NSJVGUUKVBCHWUIIXLGIIADSTBMKRMCLZSYECDRZ CTMKVGNLXYPBVTWMRAMKUTGAJXQOFUBQEZHABAZF ZKVCXNNXWNGYKRTPJMIWMLHIGOWBKJYAIQTOMEQA TQTUKDXMSKLUBBIOGOAYJZGMWKIWRTUIUMYXWNFS TPNTFIZLBBEWIUHBAQSFORQYKSHMGNSZVTLXDEJT DQJSABIAPKNTRSSVFPDMEZTGEDUKJNKZYVBNNMSU LQIPMEDHFPKHPOQFFRRTNDFVVJFXWSDUPLGUGPXV NUPFYJVXKPHUXHGBFZYIYVQYAUZMIDAAGZPKYGZL ECCYHCGXUBKWQUBGSXFSUKMKNVFMOXLHIPOKPXAJ HVJWINJTBTJUXLDVNRMUTWUMAEXKMKZEHCCDJOAK SEHTQSKEPHFOBPHSYQEGLANZUNIZXTUINTRKLOOX DLXXXAYOHQEMNUNRJUZORXENNLYNFYTHJIZQVDEX MVECOQYJHBSTBHHMCGDAORNZGWZNUGXCEKSXHSIE ZHLHJQQOHZYCYOQYJONHKNUBGSPBDKYPERAVDJYD ADYVVQDOEQCHVLQLPDUOPDNQVIHWCSJATKVJDYOX DERLHLPLQIJCSUZNNXLPCSSSXDREOCTCVMXWEGQF ZNNJDEPAYRYIVSXIVKJAWQIHKBFSMNCJYOJUHZGA HKYKMSTZENERAALWLPHPAAFZYSAZFSWKQZEECJLA QFPDKHMYSDKWNCIQRDCGTCEKWTLMECECRNXGQRJP JYKLYTNETMXHBRASTCDTHEFBXFYCGJNMXSQBUXHI BGKOZXYIQICJTZYLTIHJJNLHLIODQROYZYWKTJCF GXRDLEMGNZOZJJXXGXNAPTNOPCQKTISIIILYSVVG TPJPWRKAWVXOTEAJGLHS
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YGSSUNWGHRJGTILDIKCTAALCSOGJVYYJXVLIKSIH UGFZGCWEEXXBIEONGZHGLCZQQATJVGAOCWVKAEHV PUNYGTCAMIARIHAMWUQKFWFUMQMKOWBSJUAPVREQ EEHBAZZGRFZZGDZULDLLZBAUWFUUGPQFQJAHYGHO WESZGEEHFEHBOUFKBQBFBMSCDEPHSVZIJOBVUUDO NDSPTFPHWAUOPZLYTJMNQLBPMJSCFFZAVYVNFYKA FGLURIDMPPSQPQPJDFLJUWTCDXCMWBDHTHPMGLNU JTIJEHKDZWTKKXBAPDUWKJKXZBGEAUQNUNEMDKLI NTXHYXXTSWDGRRFKDCSYGNQPODORBDGKUQFYZHYV UWQUAOXEAZGWWAGPCJRNWJWIQHUVTOQJGDKINDPQ FNGACJOCMBCIAWOXFQJIELUDVYTLTBMRUYGODBRQ UGLQONNWEDDUDWCVMZCVAAVPXTSYKOVJKLRCJIGM RODIBPFNEMJBERTGPTYPZTDWWIOHXKUNOAONADZS VEJEEJPXNJYWAVFJBQLVEIAWIQBYSYUDFJHHBPXX LQMBUPUTIPJESKBIRKKPQVYKYBETULJHTBWGAXMM ZCCQNNYDXDOGMPAKKSLSDZQEPZLNGPAEKSSZVDOZ RLUFAWOHNENXARSCHWPPQRWWDCCEKZGDGLQFCRNB WGNSVOFTTREJRLXJNKMJUZSCPLUZNROOKJIAPYKS JXLEYSBGDMYJNMYHYBBDKLJLARVZNBPVFECNHZJK VXZLLDUCFGMNHMCZAZOWMNAOXDHZYFQXZCDALZMG VSWHEHPYBNXFFPRKJTHWVHIQAICDPKZBZUPSNVCU NNYQQGVDEPOAFVDWYOHVDZQEXEUYDOKHOLOQEHSV OBZWPSIEHQTMBEBHUPTLPHHMMUMCNPHGPWVCUUPD QUPZGXJRWJAFWTETWOLZOLHUUHSOSTMQMNBCFAJR QGGPQKXIVXIOEEFFGDLOQGYMZQQIHFWOQPTLHTDJ JSEVFVADZHEGEAGOTGGBVEMGWBDVOJWSLCKAAQMI GADMRDZFRPISDXHNLTTGXOUKKPQLZZQRKWCLHZVN OWQNMVWJRIALIICHMRBSJVNXKREBHFFLTXHICBBQ FKQOWVWGBTKLOLTKZZQBGAYTIDVBPLHVEBVBVYNR QEMCEDVBKLOFUGHMRRYGOPFAGNVUWUSJKCAUTGIH QNLWRLIGPQHJJXJKPXUCSLFLCMBVTJGKULEYMDIM GPLJOHZSKATYLMNJKUMMSPWWUOHEZEOKBMMNGPZR TMOUVEHKNSCVYIDHAXNEZAABAKDJAQUIHPMDOIPW HYLOLFPMLLDUFAZCJPSPSAASUQDKXFGDCUCHQJVG IXQMVQFHMZMFGRACIGENRNXIVWLDFOPTYBINCKGS XNHJVGEFWOBETGFRZAIBOIUWHHSWDIKIGBRHXKHX RVXIHPQFNHBJKGNRVWKLEGEZAVWWBUFKBSRKAEQL WJRWGHSHHIUMLLWMOCRTOXXQZZTMZRPLEROCHJMY OQRDYCDFMQAPCJWLJYYCWCPYJNUYVPDNDHOCUNSB PAZEYROIUVYISTFPMAPRJNSTFFLAWNJJXGKWPIJE TFGQQTBGBGTWXFRLYJYWKLQGDTHFNTLIEALNJIXZ RGESLDRHTYIFYVVVWLJECWSSSJEXNBXESEBHBIZI QJRPPOZWGMMMIQOHBNNCFGTZFVFPLHDKTXWHRWBR YIEKPRHCJXSTXYJAHMATWSFULGQTXRYNIFXGPDVB SFOAISVPSOTRPZMKWANTLGJMCRWZKAXSCBFYGKJV SBPWDZHFXBXMQZVWDPXMFMVKONIBQCNKOJDNLODJ GTKCEXXUAJGZCAFBGEUTPZDUOZZJPWCYOULSMSJU XBOPQGIEHNJYMFALKBBZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      YCXNXDQDUPFQSFZQETIMQPJQZIGQISKZVOZMZQOR BLLBEIZEXWPWAVUBSZOWRTEDBDEXDQHDHMLAKQLY YVOBRVQNITKEOUBNYSMPLKFCRJFODPNDKLTKSQMA XKNZZXHHUXJFBYWAYABTNSTYMSQFTSFHGHGCDJCM ABXEOPKMLQBTMEBNGHLXBYFXCVBXZOHDMQLIGJLH POXMWAYVNPDRWZEGZASTWINLIODPUHEZAVLINWCF HBWLCOPEFPZUEBJLOGDSZGXCIZJDDCDOAPDLQXHH MROJRKZELCFLVDOCXITFIOFBNIOWELWSGQNQPRNU PXCTTETRDWWUYFMKHZMPXDRXYUPAWVIMWVXWKXSO CGVPENGVLSOUKLGLRJSULXESNGDOMSKNNOWXJXVC KWIBLVINTYOROGAMRLOULOOTYBWPCCHBUADBPYKL ZJLZSPFLXDJXBVGEKREMBOQDEBHEFMRDVHZJRRZI JLEUAYESYBUSVYAOYORRRYELFJRJSWELMDGUKUBR UEZANIKDMQTKXJTTEXZOBPERJNSLGTDRVDAMEUXD QLJHHJKHRJEATNZIQDFVZDUKJJRILYEKOMFUZYQG QQXJGFZCKCEJEHPORPBGMDUQRWEPKDDXBUCFSJEM NIXRPULGRHQMKVWDNHZWWRQTHYSOYTDDDHZFWQZH WQVIXSTEEKCIPBWJPUPDLDOTINLMZXLALAPVHGLA VFCDWXSBTZGHYIEKNUDLNXNMEVWMDLGFZXNEJNQQ KUDHZVQMXXVIVNLAAOKHVIVAAHMOIDJHLIBVALZG TAKKXZSQWJCWBROQFZYJGLZQXHGUNALTYTTEPWFZ YXNAWGQTWJRIXTZWYFCZZTQOWKIPYNINUJHRIMPA WEHOZMBCTCOKUCLMAHIUSFVREENKCZLZWJKFQYLW CRKNIAAXVNVWOQFKWSZMAMEMPORWMBKVNYDJKUMD DTRNULZDMVVRHAHYTCJMIKWFGCRRNXDHDPLXTWAP BYSBJKIDZKVFOOEQXVWGEDDNQMXJIQPXRGKDYRYL USUJFQPIRFARVMOTVLACSCVOZINBJGSZFBCLLFJB OSMXOXNQKQXULXHJBBXUKZMZXRDPOIWPVQFOBGEC UTVAHGNDSEWHNPSYBVMWGQJORDXIZTBRQQARZBJX VRKGJUEZAVPVNNMIMIXCLLXVDXZAZBFLRKQWQLUP UYMEQULNHMEAPLUHQDXDUPKPMZOJWGGOBUTXGGCJ NHTUZJQCYFVHHLXMDWAUCYFKQQGINOWVTREXOXJB ANUMRKZBOUYXFXZHJDWMEYSRWKZIRQMZCZHNOKWC IJIPVOXREAGRQQBXBZDWJJMXOCTYLWYPPWAZACRX LRJZHYCRACRQFPIPABTEWVHHIRIMDSUPEBRAOLAI EXHXFJSAKNVVOPHVXNCBSTVCCXTBSOBDLNVXNCGJ LQIVRFAQFLKNDMVFEJGGBQEZTMBNQPFCJAQVODHS PKWEMCEIVIVTYREAURJINDMFNRERWIWLOGLMKOOB CVZLWARKMHTATUNEJDMQRMCVMJFMXWJQXRKWIVTN XXJKOECDPPXMGTRHJYUZLOTPKKRDZUYOPRJEAJOY OJCQVTMFFMFBTRQRZHEBGDIXVLTCJROCTRRZXILF UBOLHXBLSGURRCZXGNBINEYTODJTRNDKLTNSXOKH YHZZJTFSEMAFQQTAVWWBRUDUSFZGWQBNRGFFEMPH PWDRIUVGTKBWAQPOSFAOFYPQZRZDIPRIYZEGLMTN QOUJPKIDZVUBGDAKXSLJIQWANWHCHTSNLCDJQVEO EAMVLLYCXGNHCTXUXCJHTHUEADURAUFCIQYDRJGA KTWEFSJHSLOHHZGERYFCBFSSSHPXGYHTRZLPMBZU HEWGYIRFBNHMFCPTAZGA
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      UEGYYDMBKVJLLHEVGMEPVJJURPQRTGJOWHIXWOWD MELKQLGXHUGQGJQFIOHRTXMDDJYOWBAZRIJBQWUQ NRHLDRSIBDPSUIFGQMXUQGREYOAKXAJGWSCCPEVU AIMTZYUAWSSKIBQBDWSXBUDYRJXBNKLUUBAUWILY GYRWQVUESRZENPECDFJGFHAEAMKIDUMRYTQZFOGF QDIJDYWOVIDQDLPJVKFKITMEBILUIXVARQQJRHXH NAFUKNVRVLBVIGPHHVGDXQBGEVDZFIAOOOTLSYQZ WHNGVQCXRNSVTYPSCRDQXXETFEJFEGHQHPKPSVBX KWOCXFUUIESLUURLOACJCCIRNOTTAEFBZQPZPJNG DQMBDYSWGZWYBJBLPJWDCFYYOTFQEOQILTBNKMMK FEHMANDEMAPLBDBRZNSUGWPCEHZEXTLLDBKTUSFU BAUOTPFZEJWCVOVNOMOJYGJFJCSQPCSLBTAFXLAE LECYIUTXLWLRKZZHQSCGPCOJIOCIKGDGIXBYCVOX VAJZXFOBMGDFTGSNIEDJUJDSJGESEXWZKFUKXGHI FLBTPXYSSEZHAZASOPUKXFOGCBTMOLUQSRIJVDIA FIDNLCHWNENILQJFPQPDFJBBNSPOJWXJGYQRDUIE GBUOZEUHDIGTQNVXJLQFDHQEPBDDCWHCIFMOEYQL SUKVGKZSOZFDLDFNCHUPKPIECNQXIEHCVNCBWNHB JPKZKCPPZARXDHZTAUPJYDUKYHRTLGECSLADTALV YPINRHJDMVEBMDDQHOMQGVTXJDELXBVFUOYJQHCF RGXBJICFOIXYGEIOTSYJKJNCQRVLSMRCNNDSDPDC HMBOFIGOCVVCHJAABZNRDLKMZUHIXQSZRKVOOQBY KAWYACRZUQKKSJWKVNVGLVOKLUVFCRBUVHMOFSKD BHYWCNAYEFGIIAYGCCBBZIJJCJQJDSDOHSTUMLNL SQAJVXLLNJFXZUGZYLMIBLFRQNRDDFFVHBJGCRRL SCARGQJGOYRKDLLLZLEYMIBZVLLXARKSXXBWHFNJ ZXEWGHXGBGMZNDHBPBQIIUVSQCNNEJDGFYGRHJDA WBWBZMGJSLSRJHIETBJSMFVDPJDDEOZCNGSFIRQA VXBVSMCTSRUHXGQCCPBMIFDBFBUSDQCTVZOZFERY KEEXGCXHWXWBKYQZKPXLMDCTBFFQTJACVWTNQRAG IBKAOVJCTSQUTDBAAZVYKETROKUDUKUNSREXXQMQ RQXXJTCGWKQBVBZMMUXPMOIAMAZURXEGAZEYKZZQ HVEDJLHBVLTFMUJLWEQOFCLSYTYWJZVRMEONWRDK WZSEJGSYXNTUPBEAIZSWCQTFGOMNDSBRLSPCVCOD TIUYEVEKWNPYBRQHDTAJTMOCBUVEBZEEARLPBOSE NDZIZMQJIIBAXEJWVAUKJTKZTZSDQTKGDJVQAUGC EGFICPBDPUCGQONUKBCCRTLSAWQBCOQHYWNVRKSI FSZIVPZYFDTXLAPTRAJRTIGDKZDIJHOYRGDGYMPE UBEMIPTRVREECHHXWQQYPATEVYDIKIVQDAEWZKDI SRLEMHTXQKEOXACXEEHRWQRBFLICTXFGCODNZLBO SHXULBFECRGGHFTPXAIRMUHTQUHOXLAHWHZYBZCL ZHCKKEASGWRQUSLMAXPRJOEKELJRXSAZUSVREXPF WUDOSAMUWCGCZVFUEDWPZGVIVEMFCDCGNCGJCJNH DBKGEQQHPMFIQMRYHBAZXFTCVBFCZNYTLJYOWLTB VWMBJDGIRRQOZWWVGNLOJWMNRVDIZUOEZHWWSHRT GCAJDXPNLYJQKMOJWKOVVWTDKIWVRPANTOBQRDGJ HUBOQZFWAIQYOLJRJSWXAFIJXUQJRVXMPDLAVRGG TGITPYPVZTDCFXZMBMJY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ITRWUARNNRXWBHAFKUPAIOCYLGKROLGVOPTROJRJ ZHONERLAZBRETWGPGJSLLVBTGFLLKDPDLCEMXOUW EGPURGQMADJRZAVPBSWMBZLHVWFYRXCVFQLYIJZD OKMOLCZGBXUJOQSRUTEBZXPAMBGKRJSRXVVLMAMP HXFJUTODIAQQJRAZUFZYYXYTALTVVSJJBAOGZCBK JTEWLXEQKCBCNZJQONSSXYJFFBHJXDGGRIGTEHWE KJGFOQDXRLBZZNXTAJGLCLYZFSFGGNUPWBBAVGST SHGJOBVTMZRABXBTWYRLCTJFKUUQFEVMELESVVJL RJFNZOWZFLHPTJQQHNPIGCYKKCFJYVHKLWHWCWVQ QADRNUUCEGLEOJSWCDRFPHOJDSQSZPDFRKJHLRAD XCPIJZYVBNUGNMOSYFTCXIMNKPMLVKKYLKWTPFUI NMJHIWIYQSRTLDMKEEDBDIIPRVJWAJACBDNYEJUW OIEXYEKDPGOLXFGWCZTPWTBBITZXQEWMBUIKBZWN KDTUNJNOGRIWWWWSMAHWPZWOUBHMTCWHNZLTLLDG YNOWBQQAGROSRDTUFICGMLGSWHYCOTQGZICJIBGR JPXAGSHZFFKPSBCYNCLNKCAFKQTSEEYINPOAQAPA NWALNDMOAJOSEDSUWENBDLGSOARZSTXECPYCNRHG WFUWTDCEJKRRXXBIPIIEWCCYOJCBQRDBKPHNDMHV WXMCKHGMCGBMPLEBZADUBIPQUSMAQPNHLVUVJZZY KOXTVPTREXWNQLVZTRRTHCAJZLBSFCKIGPSSIQJC JZGOVDXQTCLMEWARMAPNWWCKTQUPGDQGYKWAIGDP IPKJGBHRHHDRZWHTULAQNKNOOGTRHDUNKOKBDLTV SISBOBVLVCTUMYIYUCJHCEMBKREWWDZQZOKPTPCQ KFBCEPGBZKZEHJKUAKHUCVWEWZFPXWKDMWAYXXNJ FYWDSFFDUDTQLLGOXKLSTNNASXICGBHSVSFSHYMG OYCFEQCQRNNEZKRFXCDFVTJQEEJHKJPARHPSZHKI IOXQOBWMKZKNYMYCSZDRNQUMHKUVXCYSQFMBALAJ DHVRCVYMDSMAPEKANIREJKVPCLYYNTIVKKIHKXEU TECEZWFIMHILMIHPYTBONQBWQHYLOFWUPBLVWIJM ALJOJONWTAWZPPEZWKQZRISKEACUGRRGQAQTHPHC JIVPUNORRYANWOWUCJNGAEIXIGIBKVLFFVJELJEM RMWCJBTYHFWQYKIXYOIFRNVHBFPLGQFHUNTPPZRI MFAEPXSKSUDYVVVFQCDEKWUCZPQYVGDUYRKXGKHR QQGJKFZBJWLVAQXCYKXYPLKUUYPLHCJVBFPDQAHG ZSOQDGGANXUHSSQOACHFZYMUERKJYFPXEDNRGUUH TLYMQUJOSRHZSFEGVZNLUCTBZOFMWEAASBVGGOFS MWBQFRTKXJIYFIJXYBNVICDTOJFCXDXXSEOYHREI LEWHTSZRJQCRBTSWEOMQLQKQNUJZRBSWDDTHRITB ZNNSFNQHYZDTJRMLHSOYIKSTBSHLLXYPECCHBYIV KOFFSYHXLUMWZYUKQQEREWKKRMAMCQXNHLDWEBOI AQWHTFJBGPGWAVQATPNAJOZASFFKQGXWCFDTWFSH IUQCYENIJQQFMZIQKMKSKWGTRNSGOGJNBNOGYFIP ATYSGIAVZFLKQGQHNJTBFCCQNLBTMURDTATTBDPN ONHDFNDEXYFOBALLONTEUNMTLCFSSMGOFGLORZQM PIBZBJHUPPCFMSOTQHSZUFDVXQHGWJYKMYCHHALW GQTPNRROPYFMYMXIOOFACSNXFNNAYZYGHYYYAFFC IRBGHISENIETZGPSXJBTQNGZJOKKEXDMEMQLLVZU YPHYKFMLFBILHUEZQKGY
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      URGDIMFQLMRAPMTUXIZJTYPSNSGFKENXSEGKIIAO IBGRRLEIEVLJRZXUPZWDKBFPVPJMJAYULNDEECER WXZGNXOAWIKIBZVCZAMBFAYFOCTFTFFDYGJIEQAM VIDFAKTOULQIULWVLKIRYJKRGXXRDYFAWQKRXXKK GPQCXOKTZLGHHZZXBQBVXCBRFDNUSDJAYFHMKOEK DHLYFUSFVUGBLADUVTOZKKWJVVOFPUJYRAQUXBYV LSPMCFLQAEUZQVLFEVHHXXXLDQFTFUOSJTYVTZRY BUEJIVAHZPFNTEQGXVDWFJKDIPWTCYLWPYFROGNQ KHPPXUXMMCVTJZHPQUQQOEVTWZUTDDQGERZNUHRG HAMKQURXAZWHJGWXSTUCMFYJUJIZWEXAZFYOFVWB SGQCKUUMBHYLYEGNKEJPAZRTRFBPFJVASHVZAHUS QWENKYWVURURGAINKKPOMBQNVBMBANKMZRIORJPO JHXUEZKPBXFTBSFQXPZEPKKRVEOVGHCHGWIZHPEM CHXTYYOGBFZQYUZTLTQEFUPJSTICOHOEIYFDFIHH XDDQCKUMSDIDDXVXJNTNTGDHNFRTLSFQJTZWHLYV MSIZPPOWRTWWNMTCTPVNGGUYJSOVTSKEIRXVIBEM YOWROHOGNFKXEYQDQUUZFBZNOUDOOKHYPNIMPXGB KJIRTINSBQEFONYMGSFBEVJGVPNYACAHMQNARKDC RUAKEXMRZACZDHVHJLUVBOVVFLIWYUNCZLCQIUFE DPGUEFJBRBPUOFLZNWWQERZVRWKKXUCUOKCCHFPK EVTFULNVGIZGYHAEPJIAPSLFNGVJIKDEINWFVRQJ PHXSCVLUNNRDIUNMLHUTUCNGQQSMFLGXSDIQGLRF USWUKPZYHUJKSDERIUBXBEENDRHCDSDEUGOMVELC JYKGJPGKSNVHTVRKSWYZZFZRCBCMYAVBUFJTFYLA LOJTJBYPLULGUYPFTOPBKPPYMJGQBQXSIDQBHJEY TLQLSADLWWCFTBXTZVTRHXBKNZQWGQHVDXZPTABP XKEGTVRRQTVTLARYTJSBJDUUBHPFIFOMEAPVHSRF NPKIJWEVPFPKMLNDONGIFDINPJBFGLDEDRZNOEQU RKXREVSAGWQCQMXLNGOLGUTQFCHOXFMMHEBZMELO QKLDPLSLVBQSNHFIMGVGSCKATRATTTFPOMCQAPNN ULYLTTZPMGGWGMKVOLYRMZBRQKRSRFXJKRNQXSMQ LTRITHOZULGXANLMSIVYQLYZFLKSAZLFIMGCTBUE MBUNXHEDGPKDILHJQOSKJLKEHTIUSOHIGHDHGQJP KERSFZJTKRHILRCNEOKRIHJTGVYLXFNWHBSZSMPH UFAFPDJOOOKJZXEZUYQWKMFGOTQFXXOAGHRDJRAI DDBHSFNEYKGDWVEVWRFMZFBJEDTVAXNJKAALRFAH ABZOTIRXFTICMLPTFOCPMDFFLOIUHADWEHYFQVKE YSAAZVWYISNSTALWBWPWELCYSGKAAEOFAHYLQZDM KUVOODXVACANVQYTHVYVYQJGSKMZQOGDUWUGTJDP GPIYSWJCZHBJURLNIZZXBOMDZUAVDNXAOHHMRESM OLBDORNVAKRRBDTXGZYFJSNITDWAQIGIBHOINQDT GYSWSLTZWAUAQGYGCKKICLAXEUACQMAMDDTJSLER UDQMTYZWTEUDRHPFAWSTRCYMLUJCAYXFFRMEHVAR BJGNRSWNOAELZGWSWSSBHOLUSBZWSMREZSAJAKXQ AIZKQJMZPRIGXHHFKOXXPTNBLUASZBOILYITYUYA ZCUJHMTWRRXPWOOXTJCPIOIBJAMHSVMVXXQSXBMK SUTLQKGZIRLJVZZZLKCZPXXPPQLPNKKKWNWPXFJY GZDWNGFQVWXKOBZDYLBO
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OAWNAWUMBDFUTBMLJOQZSFIKUGEAEBBSVJVHVUVT JQHQMXPOIHYWLSEBXFGRZGRNZZBSPFYVRJEHCMTT DAKJNFZQRGRXDCHDGEACQVTRBFKPDWGSDHAPAIEI WAFFYLECUBDHOWDOEQNVKYPGCBXMGFZYGEHKTOFB APDDPXXZALAERQNZRUBXCDSWMUMBHLPWVQAWFLRE CGKALFDHFSSCSTKEMZRQYZKJCEMPHEJCUEUYAYRZ WOECWOVVUKAKQEUAJBTQGXKKXZKQNDPQKDMVSSXX JDTDSHZBIFLJBTCKWGTZFQJAXLPVSULOXURLMDSK VSZABFPFMIYZEHYAVORODMJSSZMJLLANOEGSPGFM CXRQMDDAGPNJMTZFIOMNUWTODJDXICGZWEYROLMC DLVDSBZGBDMPQGCJTPVTVKMIGOGWPGWFPAMDRWRY RJKEQEMMMPKSYZEZFFGQPWZOPUABMBBQNTDXQTZS VKLVPBSZRSDKUWTSUPURNTDDZPVYAGXBTEKRVNFW KXWTKSBFOUCTJVGWSOPPPXCEWAAJYRAHXCFBNZUP ROQCJXPVZLXSDFAJHEZZYKCCEPJPDZQSVNIHGHKM XDFVTWDQMCLIGPFEHNERVOIEUWVNDJEPDMWBDFYR ZZEGEVPVMRZASKAEOLGFCHVONBHVBCTKLFZXVCDM RCGUKJSNAXRPIVLTLLXOXOJGWGOUQZMXHACTFKPT KDOMZMZGEMWVCFCOCFRWRSDCTYVDFCVSPINAHBBU CXSKBNETVKPGPDPAZCJKXHGWWORJNXYBNMFHPWTW CWOBKKRCRWYHXCZRKILOZVIBOARHEDCGCLXBJFCT QYOOKLPALRREEGQZSYRQHWCMFOOICBVSOCDZQKWR DKQFZOFSJYBESGQMOHJWYDQMUGIPTOLSKNQANQGS BMAKXJELZWRDYZZHRDSQAHEROKALTVBSLLGZOUHQ AWIOBLXIADOGSUHGVQJNHVIWRQDUFLARBADQHVCV TOBUXNEFPSMZJHPLPOTDAJKRJXSSZYXPBCFPSAPT CGFHHVFJNUWFLTDLAHNDRBFMTJCUKEVYPZNAWTNI GLGVUTRJJYPSYSDXJAORTBMERIEGYPQEYTLWXQVI DSSPNIXMKUSNBCUAYHSQLPUXYFNKWDQADRNZEHUZ MBWUJYVFZDXWDHBMGACODONVIPKXINAIFNVCIDWO FSZSPLAONMKEMJHAAOJUZLGWFPDWEXZGQRDVDUNQ TCNMFOZEFCGNHRTMOJRXJXTNOBIDDBPTQLRCMLAC OYLIUZHDHQQIQOYVYYXRTXRGKBLKNVPDCLVIEUXV VEKSHTCJGCWPHSKRAIXOWYHGGCLHCXPNNQUTJLQP BGJOYQHCQVSKUJXRGYNNARSCDODAJEOGQMTRGREW WLCORRHVZTGOXDQGJYTTEWEEBMEQGHJUKMBIHUOR NJWAWZYXRDDIWNBNJORMHADTAPRHOWISSIROHXDK CFFXJYNEZRKIAYHTPBFMDASXNGJQXLSIHBACDABM ACRSIBBYQLZCLQLPBDHMUUWURRRPHSSIHIAQDSHG ZIYYPIQMCRMAPUXPTQDKQGBHRSKKZZNRGLJWJWBP LCOSBCKVXVIGPFVQYFCLUMXHQIMVGNJKRZJXBXQZ TURIPYGNRRUTRPCTOVBPNZQDLSXAPNRDVHMKJZYK DFHUYSFUCDWWJHWUFSIYVOHRNOUNDPJHCUBZLBOQ FCCQSHOFJLYBKMTJHQMGTYWAEPNNHYATWQYUHLCD PNZVRUDOHKTAQKQSPAHGXNGOUOIFIDBSDSYODUHI BMJNLLYAWIUIREQFDAJNOVCRCGSTHDSMMNMJHDLM OFTXCMGADYAWKFNDNTTNAFLEFUKLTTDGUATLPMHR NIUHAXNDPCGXMEFKLBCC
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TTFDLLOAAGHUCRMQTORKVFDDZFQBGNOUKFGSMFRB IRWCUJDIGLCZIFACESKIAKCDLFRMHSJFQRANUENA OEUSWFPSEBGAKVBQNIMSZGVOHHDLRVQINEJNDQVV ALTATZNMMKZHXKSERLQVNQYOVPXKSMAWNOKGATTG LYSHSERYZYXEXVGBAJVOZKJCECAISTHBMKGMZXYZ GRFRIIJOJASJWGFGAMFNQLCEOQALZIXWDLNKKEAS AJBHMBBVVXFDGTRJPMNCFJDHYZMITSNIKDUYQMHL YODGYBJCXZGFKAZPGRDEKSLTCQFSZTEMLONIBXFR DHLPEOQGFQYDMPQIJCGZXHTBWJFSXLKRQPOJQCVC MZZXTDMVLZKFGLPMSPNJROIOWLBMPOTPVVWUHPXV IRGZMPXEETGHVIUVMYUIXJPYQVSTYNTMPOFSYZKP STFRDADUSBBJKWTENFTFWJJYBJERHCXBKWNBRUSY KQCVFGLIUMFEPVCMWBLYAXRMOXTEIFCABHSXBBED DXZHEDTXFJSCCGGTVKCSIVDIFCRLFUTDRITMAHMK OJJFAEKQRGJUUOVFCCNNSBTMYNYFRDPWQKRGPYBH EETCJWJNCYRRUWDTETRIKWEVTYNQELLXUYEYBOUO ZTIWYGWOUECQSHLIIFFLQIEEHFKFZMTRJFAJVROU ODFLKCOTBDHQNXGAWGAYLXYAQFIQARHNSLTFGZKS UOEJCNEBEVYPNFQWOCCMQDGORBKAOOBIWVAWFVWM ESFNKZEKRSSTIPILIZCQSXCGSANSFIBTTWVCHZUV JYNDMKROROPBSYHWUUJGJXEJUIXIRKKKDNQMUGPL JJKPTKIQRUBTQLHPOBLZOSGGMOOUNXKBRDSSKBNB LDPRGGLXCAZGJRLHZPXOLGBKSBEGJBTZWOROBUFQ GIREVCSKHWWVKPITBIEYVZZSJGYGZNTXNOBKEXRZ QLCQFUAWCTPBWGDBFCXELYGSHVHBTXVBQYJPNQQN HGSSJJYZQDROIWQGTJVGYPYWUQAUPVLVJRONPEOY XKNUMBMRHXFKWZIBZOTIOSVOLNLOWVQIGOQTFIFU XAFYINLOVMXDTAEMMTSEFNVVLEVCFKAJAGMBLJHT WKDKNSUECOGEKARWOLVOQUQATKYGGVQZSKKOXHUW FTONPBZLWEPUDUKZRIYBYNYBCPSVIGPASXMUAUGL RFAAFJMJPTSLXBZRNSMHLNVQJZODTLUBHFFEBCNK EXJYJLCBFNQNINHKHBWLPRAXDESJCJJSWIPVMZQE FSROAICPKFJUCIJDIBJBIJKJNEJZHSLLNEONKFQO QOZOXFWEKRMWFWFTWTYARZJKRHBWENKHHTYEEAUX ZJVPUJEIOVTYRDXIIVOSXSLQGHOYXTAINPQRHGKE SCCEKTDRVVCFOKUSYRTBLJDHQJCEXQVWZQRQOULL RHZPPUBMVJKUFILXQZCAXUCJHPMJYXUXQYFMQIEM MGETDYMDYUNHSICYUPMRZBZVRTXGWKAHJEUAIALG KGJBRHGFRYYFOOTXAWKVYFPXRHIMZAOGQAXIGAPM TYVAEUOBMRGPMEELLJADGHQWUQNXVLWZGFDYQJKC LKQAMEPHRVDUUFAIOQFUCUXNGRBHPAWOVQNCVGYC BKHRVCXAZGOTDKDUMAQJCZHKVBFBVFRAGZDSDGMO EVMHTKJGZYNYMOBYFKLYMUPCJUQBLZPFJCBAHGAH EHVIHFZLBIHQYPGITIQKKOWIXIXGZCUWPDAWQYXZ CLQYDDWJHYHWOFFGPZZVNMOLGIYWIJICCWOLCICH OMKFBOMUEEEPMVYWNXLHAORBJPUNFPMBYGSYYXHC QHMNHDHOCSRDMBNYTFGHITOXSLRYUIKRKVAPCHFV ZXYBVYABEKVBOWHESUHT
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      WQKCABZWHSNJBRSPPODQGKTQHAKMVQCINPHKKMUU SGIJZCEDNQMKBRFRKEIJRMMYTROGYIMQFOGZFFMW HXTNNFQDLBNDBTYFNIJONWTWTICQMKIEQEHYTZSN LZSEUHLWYUWXQKNPNTXMQGJRXDRYLYYKFCZDBRZF EYOZKNQXHELKOJLEAFBFZTOJTQFFXHQLHZNYMBVZ XGEOZNZTLTOOLDYSCKYEUGHZUVMRRRICOFBZAGSU RWDLFDFNULMPWDCNYZUCQBCVTSZTHWDZXQFAGCHR NKMGIXKCHGRXZKFVSJGDMYSCSZOZYWTZEMFXJJXV OABGFJBABAOBWMTBNOCRFYIJNYWYUOJFLOACDEZT AJHZGPWOFXPNIFDRBQYRCRTZXYXGAQJSPHHQSDDY ILSZJZSBMCYEJGMMUILKAVAIFABKSFAKKRFLJIBV QBPUUKDFTASHRNJTBYRBPNBBBZKOXLUTREQPRTOX ONPDLGGMEOFDRJFFBOGUWHBGAVOFUZQDNMDMEFWU CKJJUIEZBVROFXRPKKFCZHFGOFFESKZEPNGNORYX TUBMUYRLWQZYTQTHEKBYDQRPDHWEEVWUAMQWADVD QYZDRUVGBCVGZNVMWLSYOCUQTFLHDGVPYPRMKTHV GCHHZNBKEEOBJLSPLRJRYGQUBQZKNKVQFBAZFZSD LYTTYCHQXEUABXMEBTKNGIVAHZPCQTFXZNSTALUS XNXWBTFFEZNUPBLLKLYHXAXDTSZJVXKERHNTJEOQ XUFJUDFSRURYLUEMZIEUMZPWKJSUQIZFOXBKIIKD XGBMPMMCAGPWQYLUTDPDDFWKSHCMDUAYJDUXWRUG BSGZFIMRSJGTNPCVPZIQVZJGLCCHJKTNDZAKSFFU LLPBAUIVRUECQSGXBXMJGGBWJECZQWIHZNWSFQZW VEUHPGHFPMTCHCEAXUJZSKTGRKHLUMYZHHNSNALV QEMLOWRDHMYFVYNAMRGMQYWGZSGMNWCWHETTEBFZ DXCMTAOJJUGUNQYPWZLOYNKDYCWUASYSVDSPGXJC MEHGLCGGQSISPCGARKUKMXMYFPNAVDSQUZYUPZOF LSAPZZOKGZWBIOGEWVIKJCPCTKQVUMIJAQUIEBSI XEIFCTPMTTRRVCLBASZZSUGAOEYNUDSNYMSBXTFV FLPSVBQRFABGLRKUQEKBPYYYCAUXNYJJUTUWNSNT AXVZWRIJPIHQDRBUPZAYWSMHJXJGMWUXOULSUJYA HXILGHHNIJGULSDPIKYVVXQVGSLSREYNAXDOSMGQ IPXBLTUETRLIHBJGGDADERUSYMYCUTMZVJFSQBXQ ZFWRGGQWZBPHTLOIOHOLBLBUJWCZMMBKKTFWREHO CDWHPTTJYKOQHZOSBVVLGMOPCAFXBFLNOFZMUAIJ GLNWJQSZAPAOOEQDUVFUDXVDUDEHWEUVRQSMLSMT FDEXTTOFAKLEOWUPKJIPWBNDAXWOCSAYBSXUODIY UOIYAQJQUMTLUTTUAQZBQXUBWFMQXZXZMNVCXOOZ NZAUIZNOXSIAOBRVUKLGSHVXAWWJLNUIBAOXTVBW UFACJSPITLCSSILUXPJKBKEVPDEMEGVVYKRIBWOJ DHUPBDXUNADUFYBIBLLUICVWZNVOPSKEABCRCRRR LCZNOZLQKQSYPIISGILAVUVSMLZQAUVUONFJOHOG PNCNPFRQLNXRBDVKJKBQLNQAYHYGXCLRRILGVTYG CKNHSFSVQGSMHEVNJDZSMZTFBKMNAJVMLRNVYEPC BGGVWNSQZVDQDOTTYGQBBGAEIPWKFCDDNSFVQRBF XFOTPXETAFJNDXLCSMLRDOVAJXBFCVIVUYZSLDSG VBMSPZEEWXIOEKCXNOJBCIZBUPAKQJSCBYXIAQVD FDRBNPHYLPHKOXPQSMDC
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      UUERUJUIZUIRQBQVMIXQWOZDRLISUSJBNMCKDACV WFSMAONDUCKKFVZOXKGOUBVXSHUIGRCKOSBYALHR UEWUCQWGPRFRFVYWGECTKKLRQPQRAYJPDGEPWMBX LUTXNOFFIMZFZRPXIJQHDEMMMFDLFYLDBNCLFRJM LAFKIICLOIUTXASLBAMPONKVCGRMRLTXXLMXYQUG CJCFAZDZLSYXWKOIVXWMZTDIRLSMQBHQAIOEBSOF ZHNMLULIVQWUZTCXRNCKXTIUKLOSTNJNYKMLFAEV FBRYGTNQLGZXPTNJYNETGEWKGMZONLMUFUXWKEMN PCWUDFTQWNOGHBYMKYJQYTCMXZCDZSRQSKUNZAVI BDDBIBKDRXYMCJEDPIWNXDZEXHQHBAPPJWVRLILF BZTBJGFNYLBBKIQRDPKASBTCGIYJBJNLKVPYOIJN SXSGYCEZPLQHCNIQCGRASPJEHMBZROLEAJWYVOEW CCKEAITUNGDYGBEUAMBAHRIAPWHDFNBACQXKGJDW SEEEQKWKHNKWKIEFCPRJKOJDTKUVFOPNSWXMUZJY CFZHHYXSQTTSTTOCOCQGFVJOUIPKKBZVTIIGXNXD RRJMGQNNFNRXFINXFLSETSFRZSBYYUVEMEIRJXHM IGHORVFIBTFRZRQOIJTXQIVBXIIREFEIDDGTDIIJ EENQZMVYLSHSUMKHCLVQYHSLCHAWZTFQSIHFOEFH FQLEMGKLZHHCKAIPUXQWPAQKASYQRPFLVMVSVGXN OZSWCVOFHRZHXTSLKZYPOQLFMAOIXIWNWTWJOFXC PNJLPPXHWRUPRGMBAJODFQYCXYVRKRRMVAVQWOTK BNKFLWHZFBAIPPDIOGOYWEPIUQDQTXPRYYYKKYVW DRHPSCVCFXYVWSMNKWXBWRLWVNHSOUWVXKERLWAD IGJIDJLEWVTTITNFZHIPEZPWOJWTJDZKXTDBCKWV GCBMXPWKRYELUKESBAJGQJPQIIGQCMJILXJOOKFJ RRUZEODTLJPVNWZZGFQCPOEXXCSJQBPLFFJRKMIW YDLMIWSGTRONMAMLPBQQWFMAZMUIUSMBHBCJIFNJ EUTOOSFUYULJOFGGTUXXSWXFHYWDJZBGXDSSUHNY BKPKDMMHSEMBDTPCCALODCHKPSVPNUWNOKSJGFGV IOHPKKMSKSSOMEZGNAGJHDCVXHDKJFOQDJGEGQRN ERCZVYSMKQMYAVMKBTRNNVFVFLCTNXMTNQPOKYKN DYOGDVDSKSIQITSHOZMKSTBEMTVQTWUKCVRSWINS AIKUDGMGDKNFIVZTMLGNYWSMFOWSHODMUUZQCJUS JQQNIUNEYVCYBVGPBYZZMDAKFGARFSKDSIMYOZKH VGUTPOGSPHTRPTUNVHVIZBPNWXXJCPECKCBQTGLV ESWABOQTXFCUSSMUEVWLSARPGFZHLOOWKMUGLGJY NHPYSCZSMLHYBIHIHHSFDNWJNSZKBDAVKXDDRWIC MUNBKXJYRSSSRBJFUUDSBKBKSHIBNZXGSPQIOKYN VWUSHFESPVBGWEOVOAQVXNGJVBBVRPESEHQIIPLP IFURQKSGLCPCMUUFACQXGRPTRDXDVBYJRPMVOKEL TXLSNTDPXEMXXEHXEFAAWULUDYRDPSIZGRJDEUJG NNUAERATMWMBKXKPXMOMKVJXZUJHPSOUHMWJLONO EJEJXCFGLYUALGTPFVOLEROVHHVZHYIRQFYALZBR UJWOATZDXHRNYEIHNBKAQZDHDTPYXJVMAVWJCSIK WHAVLIRLSPDZGTTRQKNSRRUSVDWTGGAFAXKNRUKS BSYLELYLAKFLXKRUHSCVJFXNIFCOQTJVZVQTYQIU ROHGVIRJUQDEHWFYOZOQBJMFQPRZSIERXIIQLLHP FAMOFEVYMPUFKPTXZGQM
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      FPWFAKHHMULIOWHALMVLRFNFTNNJPLEGVOTYMADO JQROKSVEFZJALRQWAAGVVAKJFPCBSZEUZNTGWKET SRKAYDVPUDYCWXOSMZPPTWXZEJYENOPCHPGCEENM MPWKBJIPXUBSLIVHMJPTXATYAIDPIYOYHIRBUWYD VGMRWLXVUOPQWQPXUGJBGUNLUHBGYDVTOTPZAICV UYBTFGTLZXWWKNLDQWUBGMLCJYULHRSDTUOOLYGQ ESUGYYPXHFXTROZJZLIEUUOCXSVMXKSRTBXJOEHL XYGEHOQBKKIBGCFYEENPLSVBKADANYZCOMMLKJNF VKECAGDFITXOWTZKXJBVJCOHEVEFJSGNVQSUEUUH MZJRZSRUWFAKDUVTEDLWHDIIGKFIKXBFVVMAEUBX EAYCYKVJBSBHCSPSDDRGMXCOMDODIAYGVDLREJIK IWOTENQBJJEQPLNUMKHQNSHTQPTOISWWFVZBVKIW MGOMRKVOPGDRWMFSOFZUFQBPTDIFTTWVBKOFAIAK ZLBFPKJXDMETPPGGJMGUUJVTVJACVPOOLADOPQTW KSSTJXSIQCWHGAHTBACBNCLJLYKDRNETJWBNRTUT KDPBKRMROIPKAPAYCKTNCCQHOQDZLKFMUOHEGUTR WAXOJFEVSDFSYVMTOEBFCGCVDOLBYNFPDEQEAPNY DHJCJROIVGVXSBPCVALQJXVMWWRXGSSOLCKQMIGG ZOBYWPHJCRHQDQXLDOKXRKQBTZMLZTPTRYMKPNKW OBHBFOEHJQSWZPUKVSOFRKGSMWLWTSSVBGQGGFMB EYJVCAHCRNAQPSKVDTEEMWMQQTEXJQIDUWQQCGZT FDOBJEKIHRJQZRZOWJGTYMOVGFVMWDLOQRZNSPEB DXJZSETEYUJLCBNDEBMWUWRPHRVVDPJNISJBQCIG MKDLTYKVLPDNSEWPITZVRQLIPKJHHTGAGKVWEJGA COZBGNBJVCCSMPHDSSIFGENELQZYZKEWSNERSUOR BNNIXZERJDZOEJNGJJAXPYUGNVJJWFVHJXNOQZTE IKOWVOCZQKXNYDFZVSRUZXHPOQAWQANTNQPUBKMC FIUHKOPNOPWDESFFQDMAHYYNZBCADLBBUTWBXLCX HOJLQZQQBRQPLYQHYLDZCPWPNRMVZNYHZPGKZJXU KIIHIUMXGEQGUOXKQNXFWJCASQYFLIVZIJNCHVEY LVYEUHQXPUWCAGETTDOALLQTRIYBZZEHDKSTFXRD SJDJCUEVQJCFEEERBVGPSOEVXOOVJIWKTCICNYKN MBTHUEIVJWUVBIHLHGXMNQHVHYBFTWBLWUHSRAVO XFDUPGYPCFFZBJIARSAHEWIYIOLCOFVIUOXWVCAK BDZUKVREBQAKOEOGQITMJSEBRFFLPASFHOHFALON MVJGMDIDDWHONARWDTIXFKAJUUODVHJQMIVMQQKR XFQOUDKGYGRDBHNDOGUDJYSPWXOFGOJMXQANOVLJ HRCUITOYEMTTGYKNIYAQNXFHMDAPRGOTYQIPCHQL YHAIZJRHVUUDOINWSJEMYALFPGVOGOJEYJZFFDNG HSACHEWYZYHCWUZVWRIDLXAWAUBCSQJLTWEUQZHJ GXXBRLMBUDXHDNDOEBSFBDEROLLMNHIQOKINRRFU ZZDZVYSTOXJDAOAZBLWXMXUYOOXUYDPGAAHDTEOV CNZDNRBJLFGKTNKYGTHDPRPXDUOZTTDWTJWUCCPB GNGNXAAYOSLDMJSETAPPHZIGZFERMFJOBNIAKRQB KRBAMIOYFPBPHEPUDGCJHTZLYIDISHOYMCAMKWBP AESJTDWKTURHLSOPLHVQDBEFSIXRSWSHZUQIEAQB JRQEZJICJGDNSBXDMLONIZCXBYRBIQZUWLPPFIVU NBBMARYOAKAEKKBBYXSF
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      TZIKUKQVYQDOPHDCAIZEXNLXAQAAOELFKLBXDUPR IRXRLPLTSXSRUAFQUXTKFVQRJIMLQFFPZEUVXXLU JMBJJODPEGRCZFRHYZHMITNZQRYYRDYKQCEHZGCE LYKHYGKLZEVUHNYXLXJTMREOJZCTLZCJSBIBZQGN XUFAVJEKOSJKNBSZIBCDAWCCPOUEFITSAHIANWDO IPOWUVLARTCYPSOSFHQFTNYAANGJUYRDEJBNKURY MEIYLFHWZRMBPKVLWCQCLYOIAHPFLBONXRXIYUTI RLMNKBKBXTIAIDTHMFUFTTQOMRIIIQUBPXYYDEVR OQMFKBUFTLXOFHDQWCDKIYXIAZSLWWSSHKNYSXDA INMBQPXWTVCRQRGVTWEUZENWGMUIHDTIJRFGUTEP SXVQLWNWYETVTROWTPIWICCEGNLONNMVPCOTQQRK OEPGNWIKUJDWQBZXJIFKRKBFWMUMZCEHMVCCYAMX OFPCUBQELDVBJGAEYPJJLWFHLYSXKAAIHMFFSCZH OXXVODMMPTMDQTRQMULDPCGBYNUICWUANDJEZYOB UROIWRFKQCAKIYBBXVEJYNDEDSBKPCVJOUFMRJGJ ATRYLTQCAKXFGORZDCPNRRWVTNVKMNCORLTPIYXK WFSAVMXFVPPGQKJNGVDLIAOCKWUFSMKUDQIMXYPF WJLXAMLFEXFEOKJWEPPUNTIXHGRTNSQPNNGPILTR FPHBHNEAPYRAFGNAWFHSTHEWFXHGVEXNQWZYARQS VSNIDXZSJQMXAGOMAYROJEIKNRWLKHWQDVYIZXCO LKDOJBMYAAPYOFUPJEEEGAXCQPTRXUYKHOAKSBJO IAMUHMNZYLKWDFLSCWDJMHALMZBGTHTFPMGSTNAE FRWLUPEWVSXKGEQETIRMJREPOKVKPREBSUDJIALG DBMRPBTDNWCUVAKFMCMZBWIEAYEBUXTAXFIMOXOG WOKSDULFHXCSSDUEAFZQUCXVSANFPNZILYBCOEJC FKBLDMRVBNCQATWODKIVSOCWQTDKXQWOIANZCOQS QQHXNUAXCPZMCQFEEOLYQZNRHVXAPGBDBGHRJIZG JQJDTCNKIXCMBUZDGBGAJDROBUACINIVUOODUWKL ZHZDIYNBUXXWSVSCLBCHPLVIVGMNGAMMLLUVNKRC TZCVESXGVRYDUZCMWCUYMBUDWATDAWQMAJEYKXSU TNLTLVOZULBYUPEJARVSQJUALHHUUAZOEYPYBLSP JPBFWTHDGGHMEEBPMAYUCGTFGEFAXISRDYVZWPRM MMRAAEVUMYHRPGIMFEPUHHAEGLGGHHGAUVIGSXDQ VMKYMCLLVMKBENNJECZZQWVIUOFSLEVSLSTVUOHC VFNBFJACXPAPEURXDUVLTADDKKBFDRQOIBOWANBE WEUQDZTDWEHXAUQESECBDWLTLZRSKMOBXFHVOKRG HKBCJOTLNMCSZTWWURYVGGMKSZIRHJBKBOMZZRDS JYGSOFESSXNCVULQGDQJLLTQVYGWEMYXYVBCCKTV EERKVRUYGRQLYCCAQMPGBTRKNUMBQAIWSCLVEOBT MZHRZERYIPJFFIHLJJJCOPRMHRACSLVUGIRZSSAE QTZCVGOSHAFSMDLAZEKTCDPVTSEONZZWXYVYNIVT IZWWBGGHFFLVYNYMEOVEVGJYEUKHMIHLLBWHFJWJ VWWGILWCYKXVJQWJJUQFNZRJZSWDKUTYXUCLXEQQ CJPIVQGEMQEWAIXGFFGBAPMMONKILBMDUEUBBVXV LVIZEEXVTZUOKHBNIDTMQZSHICQMIVXFXFCAFLRT BSZKDUMCMVERJJQQKJSUEBZYDKDKWTUFSXBBAGMM BADWVMISPSODVQQGBXTMDUCWABOVVKLIDCQQMRPT QHZIHFDYNOWBDRFIDOLP
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      QUIVVREJJCSIPSKRZBDFSHUVBREJJNFCYANBQWAK LAVXGUDRZCDCVIHNGDEREFJAJTXCHXWWKTYCNZDS TFPYHSOGOESFZCMVNFWKPYPUSWTLOGEPNPROMLQD LDWGSMJDXJAUKIEHPNSBRNKPBHFLHWPAKPXLFTUR AWYJTVMFVDPLZKZBULFZLEMQBTCRWUWDQTVGEYPO KEZRWIYRJLZNUYJBBAVXODJWCYVBXWAUGFWSLCGT WJSNOSPVNNKJPSSVIYLFRTKLAGFWSFBXXYMAJTDF GBXMRJUOVOTGDGTHAIWQGVTNOYRFTDJOJBIKDBYU KSGJXJJWGSTIRPYUBVEEGQBTZQNUBELWRDIOADWJ FEUXECAZKHQPMOPQLWVMCGPAANVNIKMKOPNRYVPK ZQGRYNILBYBRPNFRMZJZIUEJBHAOUPDKMPDQNNGR KWKAJOVCEVXXMIWOPMICVBHSSZMGKIBXUIFDBNLE LHZFBVQLKSIOMQLPZCDYYJMALUJYLVQSBVFEUNQO CZBIVLNWVUQSJKDYOHZJPYBQQONMWDEBHWLNRBIF ZOCBDFOEAEBAVUJKORHSUMBWXASXXRJADWRBRXRU CNSNDAYVMDJXJJYTASPJQVXWLYIZQJLFZTEMPUJG DBRWWYBAIKHZSCKBYAYCYOXBIIJSXGJPWMJKUAIW HKITQJRCCQDHBRQCVQXHTRKXXFRMGAQHRFUELEZT XQPAVMJHGUTPSCCIFPEVHMNHBWGWIHBFZSVOJRVR SKVRBGLZHFPUCGTRQPQIKKOUKFCCNAIHNMDCKTZI HSGZGAXWJGLBCIAOBZZISSEBVSIHADILSVZDXLRP ZXOCTPXZVCGXKDMTOQQVETXJLEVOGZPCMGXLALHK HTKERCTSAUQXUVQZNHGGAKUXHCMYZGTAFGXGJGSC DSHWJSBHZYZQYEIDPMHHEMTLSUDBYZWVGVDBBASW TMYKUAHVSNHTNJSRQZVLAOGEGSOYCLGPDLPAFWHO DIIEUQBAYOXDRHUJZYCZPYSIZAOOLFQHLMCIJULV LGXXGJMMWMCFIIIOGOEAHMXPBGYUCGZXONCLNTMP UXCAWUOTZHSSPVQPOLMJAMMUTUROOUWJFQVYBLTY SOTMFZSUWQOASOFPVGJZNRCMYYPFAKOVYTBVQXNN MZUQFTSMLXSURJNRJPJUBYKQRYSXHUOXDHEXWCEY HRZHSYRRXDQSYMYRFUTLCZQIQGUYZHMBAQDSRGUB OLQNVARSDIOYPWOIBUEVLBKHTKDSOUWSDOBPSNNY AXYNYTYDLOAPCKFRSWJTOBAPBDLGOQORHBDYPSHM MFXCIADOPTNWVHWZEPJYZQXMOICVBKOKCCQSTJHD QVKBZKBZPCFYRLVWCTHYHPFHHHKSEQTQVHLVPZYJ WZAMJEHYZHRXSAGTICMRXZKMAFUDFBHFRJYVVQWU FWQBCVNUDSFATVBYFPVGKXBOXNOSRRADQEVZONRJ BXVGBLMBMMAQOIEMPUOTDCNRVWOVLLKUJFOIGMIL BFYHHYKISGFSYUTKPGRZIKKZNOGFOWBUKGRDUDHY BPGOJJOOTPVMBLUPTWWKLLIKFYFQYPTHQXJQOGMM OVGAFHNQMKJPTZSSYXMZOEHUGJXGAYUCKLWCVNVA QHVYCSKVCXTUPIGNMTAZJZQBIPKFZYGPWLLWTDOH ADWQBUQXKQBBCOUKTFYQLYDSARQNMRYRGKRWOJBW VDKBEFXEWJAMWRXHDJWFLHLSZVUKSYMNRWYGHRTK OPLUNHYNFTAIBYRUDVGLQDTQBMAOEINPJRYLUOZM PTHKZKTSQIHCWXVBPSTFVGHHOASTVCGRRVPNJNLI ORWHLSNCWOQUXJIUISRWWANLNWQUQYOJMGZFHDVH XFMFPFLDFXJDZYAPJMHE
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      RIEZOQJDKXGZNPWRVYIYOEPRMLUTSGEIPSAATQHT IKDRYSFYSLQFSFGJGRKHPGALOIQEATPGYOBHMAPV JKXCMNBXWPANORWHSFPQWGDRYPWAINNYHOYVTXOB NNEEIRMXUODLAZQFUMBAHDCLXLITILAAHOWOKQLU GPDVCAHEPAOXFSXBLBFBBGLIKGUNLWCSTRXBDVFP GUCEJOFMRFFXWPLKPGIOQBHYJPBGIWYGBSMHECLS UYDTUFZNTHSCVGKEVRAWQOEKLFLHGWJPCNPVMZSL QVOJDDYCAZFKZHKKYLXFWKDEPNNTLEDCXFYDYYRS EUPOFWXGSGLEDROBUKGLPIRFKXGHAVTSWLTETIAS NJNIVWQHTJMGEXHUQFVIPJPEQDZFKNRDTGGASYKD WLFQHLCULFTYTCWSYJCNMFJIEVJZRSUPAEPGWKHC YVBONMZWXTKUFSLOPPOBZRGXDJQHFUMDBNULVEGU QYHBWRPTFQDAIMMGTGOULXQPDFJQBQYFCQOPDWPD JJVRIWVCTCZOCAZNPDJXETOLKRJTYVVBOWZHFJAA FPFKALFNMUFNYVAVYDZRAYSCBBBVIKTXLNXWEPRM DCJVVPRFWIGBJEAJBQWIGESGFXZEJDLQPLMESSMX LTAXHERIIYKEJWSTNZJPRZWKERDMJWPQGHFKBRIO YFZIVLWEXSNKYTUQOLWIBGMWGEERTYEUKMEQULTI ZGLCZVZAVMFXPYOMWLPRPPQMZYKAEMZGGCBYORCS GCKXKJULPJUKSDHRATATUUKODRWYVFIPCLJXTOEE VUWNNNYREFVVWNKNEBNJREWXZPGQWEXYEINIYJFM TLGMTYHEWGJSJMOCYVBBNKWALKESRZCRGHVBNUCA PHFRVRTLKWVWQPNVQBOCQTERPQFWMKGFIENQKAFJ HRGBENMWREFOHIIDEZEDYLGRDMREJFVGSTPBSKWY CURLGIOHENOBNNBOJMBWUJBMHWXFJXBZZLPBEZHE WZBVRSFZZJMCHCYXXAAFQBJBGQRNJXWGJBYPIIBT ISUMHKQYLXYETWKDVPJCIQXCAJOOPITALSGFTXPB OZSKGXZLNACPMUWRXEZGNYLVTWTKLVJHGGJTPZFR NGNEXXWWKAMYRWTSUOVAXTTQTRCZSXFRQWVKJYZJ YKQOIUKQGOGGXLWBQJDFHSDZWBBXFZJKAJAGWBTR RXTYZOLLYHJDNCXEYVFYENSGTBVPNAHEKKUAVRCV RQEFBMBLIHCTREBEIZKGYLZDPSSQNAEVUZJYDMDE DKIOTKSMDPHIMZTRBFMGRLFQLCOSFXTWOUEDCODC JUMJDIQBIZXZRMVWVNMXKPMDCYIEPRCHNIHLXUTA JKTORGDVUPWMMOYBMIMDXLULPGMYJUWRZTMMDZQZ AJSJORYGCOGNPGOYPUAVZCXLPTCUGRETGRTURDFS RALBXBTHSUMOHWVMCOOYHSUZTACSXBLVNAOMFHBI YTHLTDPYHEEOKGIAWUHVRPXFTVORNHDNZWWGVMFQ KJLNYOHAESOANVYGPQHPPYBGTZHPLZKUDOXWCJMT DLIELFZNAAAYAXGNKMPKILFPGFDSWLPJWOOLPIVU AXHGJNSVTEZJZBSLQSKWSLYGJRTYQCIVJFNJDDSA VUQEPTRBCDMIKVOQMTTNPTOXKMJYSAPLRTNVJWYC CHKRKCACCNOWTSSBPSCXYRYCARJNBOQCPKJQMJLX FTBZOLWJHQTHULDSCNVQCLXJLLFJZAPNLZZZCVMP AHJWMDDCJGEAZYCWXVOXDDRDHXIMXBGSUILVPXXZ YQTLWXEDZBGRYQLSWQDGEGHOBNLTAWHXZKMXFQQC UATESHUWOGRBCMLYHLMUJVTJEZNJTHTAAQPHJBCB SNACTFNBNYKOMCXOOPGT
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      HZPKTGJPXZZIOLXGAPPQTHWNWBLQFKMCISKMSIPG UIUHYTFDKNCKSVKYYKOLFPNPKUUQHSEEFNPPLXFH VYUXNJWUGFAGUGKLUTJWPMXIJLUFTDYJMYRFYPAO RBNIZCFJTITVJRNMDABWUMEZBXUOMCPZDKXKDVKB SRXEYKXDPCBQTUOLOOONDFEKYXSCPEIHYBLGPOIK BQABRBSDFXSEBVKQSFOOQBKGULABSIQINMDOLKDF GDDMFWSBOADXNQVWIKQYSJYNCBCORTNPWDPKMIOW JHOAPQQILHGNWRVYFQAPWZYHIHKZLMUVLCHSDHRG EACICADRVBELRERHLYNBCYLTOBHKRIVCVICCNKUZ INZBLLRRXGNZJOWKRHAUVUVPPQNWUBZJFAJTDRML YRAOGTLRBMPDVDNQSZSUKWLZOAOLFIEKHTGNIDUK MZXKXEWCHLAZGSDGFTHHZFNXHJUIANMNWCFNYFBU YSAQNBLYWQAMWUEEKUWAYYPBIGPEWMDALKLQGDQL AALWCRJMNYESYRANKSGJNJJIWEHMMMGMWWQSUGHV YMYSPPKLXIRVTJMJPOCXNBBXQZZUFOWJISQPYEGP XPNTHXZOVHCZNAZGUOPCJWHOAIMSMPUDGMMLWZIY HNYEWKIRATFSDAPDQNLRRRNAQYWQNTKOSCQNOLUM BOGPWBDDXWDBXGHPDNWZPRGKKFLUGTAREUUBAIQT MQXVNVSQWJQYYJKYWOHYIHGEBFTXGYHEUWJKELVZ FVYFNNGRCJQGWAOEUVITIEGRZGYMPSPDSNXTOGSP YHEVGYGNESDFKZHLVMMGIYXZFQPFJOFIADDVYOHM CPQAFXGOOKGABOIIZIEIOLETNCPJOIMDFUFDZAOO BKNCTCIBKJPNLUDSIXAGBFIDXRFELLKBAOFYIZTA USLSXUOLAHWRVRGXOSUSYNSKOBMLKTWQRQLHZNQD BNSGNDQQNYYDQQHWADFSWMNPDNQQDOVMTGCJCYVH VSTIOYQJBCTHHHCQFCUFZEQXVHLWPLCHCGPGDNKK XZFEZELIEXHYMMRYEOSTTSHFOYZZKSRTZSCAPBZW NRYGPDBGSZKUNWVRGRPELWQGZRNLINLYBXWRVZQY MPMTNOLTIKDJYDBAZVZMTBXIHQTQJYOQLAJJPARF RTKZSHGCRTKDHAOOTLGRIDPXSGEGYHYJAMPDQUUR MEMCDYWBRBNQYSNXOWBFLUBMTJDSZMYARXIHUWSR PQZFINYZCEZWONJJVFVRPBKWVLXEUSXYYKAGSXYS IVKVKPHIQJWZVBLFTCAKMCTJACSBCWVOOMXAPXCH KPERSKUCREMBTLQIRAXFBLCNMVGIUTWAXRUKCMIL RUCHPITOZTUKSTOVSRBFTVABONHXZPAZSYWJEXGN SVVUCTPGUFUPDLWKMUKYUDLATNDSQMSFIFHBXYVY YKCBPDBGRFWGUHNKMDICMNTHGVUVPHFHFOKRZEYM ELHGTGABSHPHHTOPGTJXPHWWIMWLKEXKQMIOSKCU JITDYRVJGLWPBWQKILTKCMHIEBUEPWFHLJEPZLKF NKUZPLYRPVVZEIRNIKLQFLPVTEJUZBCWQNAPGEZC XWSAZPBTNNLDTYCBXCMSUKEVIGMONUQSWRBXBUFD LUIVSIZNGPFUUVUYGUTUYXOXYASKAJEPMQATUUHO SHYNEYAJNDCRCIZHEXFARJVKUWLXKKOAJFMVEXBE VJCIZVAJRLWQOYSSAPLZCYSZONMKLRQFFNAHPPMJ EWOBYZGSBWGPGSXXQXFLXEGBLNKJGNMYRWGVGPWB WKIMDIIFORSLQMADZFJAPXROESBZYLUIYNLRTOQB LYCIBUKGHFSFNLVPNGLUUCPYBDTALYDTFCTOMXZJ TBHWWLGJVAFCQWSOJXEB
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      BJAKRLRKAWUKOCUOCPCEGDTOMGHLQIMSUFOTNOGS WLJRQAZTVZJLLENTMTKRFNZBNSJAFOCCWOZADMPJ ILYSZAKXNOXDQDXFBSINVFVEJSHBPLWGMCGRQJLY EOFHJDPOCOCZPDWFTEJKOQVLZBGSHQQZRLKBJDMS PSOCEKMCSTKHZONPZWTYKWHWKKWCTBRXBLXMFENH RNSDILNYENLVJUUQHGZJCLEICBWFRSKBQZUMIWBJ HVRZDQQSFHHUYKBEIMAEQLHSUCODCPFBJKSTBAHP XERSVFQDGIQLGGSMILRCQNQPINIFWAXERRZXGSJA PIUAZKYFRPILHOTLXJYWDMMKVAXCCLXYJOEUEDYJ DISLYDIIYZUHHVHBEZDXQQTRYTMEHZCICLKDQEUQ EHPCQTJASSYRYCIRDPVZBLSRQCBDLKRWYYEUIAKA ESKGCNSTQWVDIYBZUVGLVCIAUPKWMKXWDYCGVZLA KPRWYZCEDMMEVGIFSCGCKAIVDRTOJFDNNYONWGIT FTFPZFEHUTTJHQJIXCQACHCKLCAIVQDOPQRDZCCP KSWKDLHIAAALIXOIQAZJXWFMBAYRMYZVNOUTNRKZ VQNGMUPNJRTXIMZSKWHBNJINXTQIRZOVLUAXFKVD KJFKHVDBSILGLLHCHTEBYSRUCZFHMDJRPKBZFUDK WZAITJPHOQQLQATIZREQRDCKMMLWYLQKXXEBOPIW UFMVYFOIBQLKGBFOCHKVFHGAFTVYCBJVSFTYGDCR WQBAIAYSBPVNZCYLBFHADLYLLHHYJHHWPSIGQNEO DOIKXOCTCIICNUNNQEASTQBSXFJHSGLRKTBAYLLR WMLZFZVMCZMNYANFOIYCIATYWIHOKVECYAFBEZHA XMYUKRFLCQGYTMXPBGAGFXJUVGMGYQYUFAQBLMQL ZWROJJZKKWQRAWBZZAGMJMIIUGIVXXFIRGPLUHSN MGEHXFXTYGFUUJRYRZOVYJNYTJTGAHYBYVGOENUQ HRMXGQDFPHNCDWEYBBMKPWHCNTVEDRCDCJQAUTOW OCGSSAARLQTWLZPSEYOZXQPHGFIJFCPENLBDBSKA SBWFDYKZHBFXNPTZIUOEABARDHLICQWXJCIUWDEE PELXXZDAGFTKQOJUJGCXNPWLFDEPKSYZQAYNHJYX SBCSFRJGSMNTILSEEUGUVCOWJJIGLXBDWNDNQXZS PVURLAFUPXJPBXJYDPEGTVMCFKJQHFVVHLEGVBLM OXXFTYVLGASNGFLZNKOENXTPTLVUXHENQPIHYZMA QNZZHDPWWEGIIRPHLPJEVTTTIKWHFVPWLTVHKQOC YXCXYVWPCKEJRUFVNPTKIJWTIZZXDAMPESLMAPNP EYYJSQELHUVTPQFIKQSOIDZTZQWBZZUUCNKGRYPS HLIWXQRZBBRYGDIEYFCESACDFQSPSWCCFIRGMOQC ZNRWZWRMOSQQFSVCWKPASBLYISPZZQFBIWMYFJNO YSDGWYYSBAKBTRFPKRQLNFLJCSCSDGVRMVTALCUJ KNEYFGIRDEAUOQBYITVOFTFKVNJVHLZYIEFBSJKP THYXLUFELFYCSZKLKDMYTWFZHETBDPQEUKYALLGB NXQEVAIDJWFUUKNVOWRCAXEOPTFZYOEMOMVACMWA GIVAHMFZCMZEFRHIRCESZXQSXDNQKVHNUBQAVWQB GVRAXDHATYMDIUXELAVKEWCBXTGTLRBLBHRTTIPV MZDOHUDQJUGSGOPGFIOIKUMMDIQGRUNQWZNQDXYS BNFMCAABLQCCGROWMKHKIGZUIIAXGIWCYDSOHQFR HTNOYMLWEQTJVTFFSBJLSXTQCDVNOFEVAVXPATVK VIMLPUFEJMYAPZPJKYAVZHWRIUQSKVOBWEOQAAGS BTWGGHHSQJURACXAGBGH
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      LDWRQLIACOBMKTOAMYOSWJSOJSYLZGNQXVKLSLMI VWVUBTPDAUBVQSAALDBZKCRCFIBOGCZWCYEZTBVJ IMMMBQVVVPNKVHKGUNJQHPBYLPMOCJVRKACOEUBS BGIELLTZFILQLNCFECYPDCRFMTOMLMKPRUMJYEFG ZTJTHEUCFIPGHACKTXVHYCJPWOVVEWETJFEZAEWP MTXCVGEBCHOOSKITTRBAHKIWMEBVGMKNNPJZTNKB KFDZWGFFDRLADMDHXRHAZIFTWCWWQFEUDHTBUPEB TLJIXAUONXACFWOFQXBZYLIISQPAMVEIYSVQBUVL RNRPKIZKVUONLLCTYYWPMVBUVNDFKJIIHZCPHBXI MKQIKHBIFNRXCDSSXTOKADFSCUBUDUAEKGDGOBLU RQZQDJZDFWDZHZFKJITWUEYBQLHHFTQUTTCHTJVS OUBGYQZDQQUOMCURBFLAFSUVCNNWUHROFZZDUXUD JRZRPZXHODMWZUVSPKWRAJALZAHMBZCDUEMKVCEC YHOJHVRNAMLMDVAIWCZITKWBSNIOQEEDOSMZOZZB EWJXVKPCQHFYWWBFCQCTRUJNJQONWQHTBEQDATYX BOCYTMCCBTKHMGLUHRFEAKHHQYRSKTYZDJRCWDTE RJHASDQPDITOVEPMRQSMSVVCNUBHLRXAZORCVPNX GRQXRQUIOLFAAXATMXTZYOREUGSLNTTKIIPWOKZR FYWWRVHWEANJBLRISBRUFKVXLLETQDBQQTXDMFRM BDVFNGBCFMTOSBQYRUXACWWRXSLGOKWPCBZWXPWV IOVOPMZSMQLZGBMBXGAYZIWJJSYSBUEFFASPYEIJ HESJPVDIZNUKRDTFOIWFMYIROIDTHVQTEUEKOTKM SHJBMUAXHHGXMDYAEKBJFEQIAJCQYGJHFHNOCMPP QPQZILGSTMNRBABKVJMHGAOJSNGLOPVBCSJZNHAX QZLPTLVKGNRZZJQOYWYTRUYUVHXKUXOODBFMCVPA RWWDXRYYHMRZTPEKAJQTKPQOAKCVUJRRVXAOSXIN WUAZNQKUYLYDGAMUMCMJHMBEDGHKTZRHFSAHGNWH SXHDJRXVYGZOPLABCHNOVEBKRSAKOZMRMRLLCQQK ZFMDNQBDEQAQEIIFAONFPLDROIRALJEISKACWKWY QBJERFKHOQBCUMBYMECZLCEQXXDMSZKKKSGGSILO RRKWYARQFNRLWMYXNUKHXEBWYMYXFBHAGXJEYOTM XLEAULYKZWRHUWQUDDWOLFBEEKIAVZXSEVLUICPB VQQEJYTEZXEELSWPUTJDMFBNJPNGGUWPBBLYNRHH WRYKAGTHUYYKWWZRFVPQVXAIYXARBEIXNZMOZMSY RCMDWQTTKEFSFXISIZXHGHKVHZUQHAJPVCCLNLBC LUMLCJXRPTJXJBVNOMFGLGMPNFJGHHOUAZDXSNDE DKRHQJFXZJDRXURCABPOANXTPIERRHHUKIZDUJSV PYFLCPLAJBHADILXOBJVRONHYPUKCSUBHDEPCKXO QWJDXIIFKILXOYDHXOQGHOLRNNMVDEOHZRIYRVFS TNJMXQIEEUADUSHRRZFQPAUTGHOEXDNLSPUHCNLB TJDPKCHLPZZBYNKRMSMQZBEVUNVSJXQFEQSTVIBA FDUEIMZNIQMKHPPKQZKDVXTEUAPRHQRSIKMGPLQU ABFXRNEXFPANZPAMYUHWKXOPNJKSLXDPUZAJFDQX VKMUEESVPSTLKNIWFNLAQLEEROXPDRZBRWNDMRCR XHWTIJIBDYEKXRVTEQIXCXUHIZUAZCZPQAFVKVJM NAHNCSQKZELWRAIDTYLOZMDYKLEZRNQYURALHYYU IDPMZFSVCXGKPPFSKDMIXMGPKZAQEDIBTYMJZKZS QCAHNVZVBONQGLEGGDEI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      PDNDCPHAMSIUBQNZBVASTHMEOASFEVNUEZFWFFBV OSSMUNRZRZFJOLWHGSWUXIMUNOJAOMQUXJEFDCXZ TCULWNUBBJPDQJFISECCLBSLDNNDHDUCCIZZQBEA DSPEZWLCNDAUVELUXBLJEMOVXLVMRCDDIEHPMUKK NIOFMMLKOJQFHHJTZWBFWNKNFNXUCTRNIYZNKHDH HFSJYEVNATCYGKHVYZKDPGXRIRJGZLXQOPNOVCSF YFPKLCBZJPRIGOIYIZGKHDJWSXWDQLWATPHXEUZT MEIMKOKSKGXMPHZZQSGZOIKFKTUIMUSOVBYSIWHN CNGENMAMBAFDQLDFJCSVYHANBEXAVRGACUVSRUOL MSCEISSCVWTSMOHWZEGXHXHGBKPLRSZXRUISYWBP DRSTRJFZBGVRAPKRBGPKWIUVDSTQJXUDJZLUMBTU VQJNUCFHUYKIRTDOKPUEHGNKNJSQNFBIJTAAKYXM OCYQBJBTMKCCXTUXORPUTWZLHYKQWIBVPATEKAJY HGFHFWNKHGZAQDWKQIYKEZHXFTCEZYGHOODKXZJY CNZRNUWQQATLNNNHWQEDCAODYOGPPKZQNXJCBEFI DZLSUHBYJJWXQNTQEQENIXYKEUZIVQJYIEFPGGPK HGETAEKGGHCFTKKAWQZJSCSTMHDGQUGYLISULJHL ILOBPTXZDXOUPWLKDEWKJQZIZJAGQBAQOJXQASPQ CSCDNXAJQLEIXYJMYEOBBSRIJNONOTFYJYKQMTHX FSLRRFILHBSYSJLRZQCPDOEPPNECAJIUVGNPSONI MDEXOOUFZUGMIEXHWCBIFFASCXTCDWEMVUUEIFAX ZRVAWFAZXGDOGTELSNLXCGMDURWWPRUDRGQRLTZE VNNKZAMQAGZAGLPQRXYJQESNDUIRCSHKNNOTRCAE EUBTKSCZZDTUZYHZGTUSSPTBEUEBRFHRSBLXYQKY WEUQNXMGVJUKPSFRBVFIZGMCHWQBWUIUPIVQZLUH OPDHJXQCIJSMCKFTMVOTRRDDIYRDDDYPBSGAYTOE HRNOXDTQHPDJHBUDYMSEKOIJRJCZDKUCJSVMWIAB BMYKANSZAFROZIMELBEFQTCMBBWTAECPKHJPLWWU XYNUUBGGJIMZPIQITKAFEREQOHPZIKKLQOEOPWYW UNMXLPDAVEPKCSOFLJHLRTBOAQBSHLWJWTCNXKFI YAIGXDEYWRPDBOOPDDLKVVUSMAUTUJNTWJKUDZVR SRGTGVEIONISCFOTKWGXZJKUGRFRCZNULHNKNQRE DHUXOAJRADBPEBAIUTLJZJMQWNNCKTVUDNFWQLTM WVLMIYUBUWHAKJAXBYLRTEHPRLECCIKWXSJYAOCR FHHSNGJARHVCGUDCGSRXZARCMNZOTBERHSZQNNWH YYIVRASMVGZBIXYKMUFWEEJKREVFAMMSVKDFXMHC HJVFHJZQRAVJZFIAMGOZPQMKRATSHNMMCKIGUFZJ TYRDUJPNSNDFXQLWWJUSRLOLNKFZBDPGWJELRLPC WVCGPRGGLKGSJFZIHLMLKTMXZPALJNTRHRAUHEWA GYOGWWFGVHUSQJQPXFEPMPKXQHGGSMSRPPYOOBNZ SEYKSGEJGMRGKJEOJXIOMSIRGHMWRIJMBSMSAPNW ELCVZIIOSAKYDTKBFGNVVBXXBQQIMOLREJFHIQRK PCMOILRONKYMTDGTXQOLNLXUPKXCALMATWSHNOBX JTRIDYTZSQDBXVAZLNHUZSOJPIVOQIMNSNPNTWEP CLHFIELNNSCVBVSUITNFCIBJVQYAHRIKXANNFVKO MHOAKQDDQKTJHVSDHSGJSEDPLSNZGGFPATWXRBXV UTPUEVWHZCURQZETYYXEOMLOJXDZMCHSDSCPVILZ ZDSNCAWZDERKFPXDVEGX
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      JZNQTXSPUUZRWWNTNTHELOBHXRWIYIGMUSPQFBUX RDMCLBTLUSMWVZQFHVHXALIPRFOSEVOLHNUKCHLN USJGSFYJHAOKNPJZOSSPOWQHGMPWRKQYEKNUTITR OMWVPRPGNDXFBQPZNPXPSREORSBLUQCNSONXQXEP YKEAJVMTYIKYFDPTDKNITIKYBLBDOEJHYIUSVUUT VUSGNSMNXVOYZIAPECKBSBKFMMRLPVSIRLNMWLBX BKERRCIZTSZNDXVBSVZEMTNNCASFYYMHPJRHHTCI BLDSUYNHYYGSTDYHFIDPDLKKPKTZZSOELMMNDEGX EZIQRZSMGFZCZXMHFRRZGUHZWMWWXUZOPMLJGPTO VSHBCZRQPHYXBGPVNOBGNTRPUXTSFSAWZCPORPNB HVGNQQWOFBRYVUYTREYRDLHAQABARCMKSUUGIYHV GEGKUUWHMNRPJPNGBCZLRQVWNQTZHAOUBQWRPFQG ZFYLMGANNULXLIFGTTQGLZRGZFERLISBACOCHZWP IGGJSDKAGZQPHNWCZUBZYEWCTFIJTYNGPUMFMDIT OEULRIUIHEVIZHOTGVRDVTPEFNWUFLFFRGRJERMQ JMLBWMZNCPOZAIXXIBFPMGWLMDALSQANQAWNFQKS BOEROSDPGQSEZUMRESQPXUGQNHNMDQQPTLKNVAXM QIGHDIQDLQZTCLGZNMSWEAQCLQCXUMRBAHGLOCGH UDXOEIJDWBGCYPBTWJJHWRAHSPIIWVAEUFYEFLZX NIPBVOLDDUFVSXBIKGQHOUNONKGXAIJQGZNQJWGH FCAGKZFTBYEHWACBKNXVKKNXGUQNUQTKOFBYTJVT YSUJFAMPHXTFGZPGVTDXWPNLBWJQTIWKNBYVHWJZ ISFIZOCOXHFMNCBHJIKUGDXYJEBTMEQXDKUPIYFB GYSFZLAZCISMTSTOEQNJCJEGQGZNUBIDYGNRYKMU LRWLLMIIOLEUADGLKEQATLEDGAPHVWAALEVBIFBM IMIJIBNNGPYQKFCKUPYTMNHYMNILMVSQQYEPAAWV SIRPWMLPOVHKQOYWKYKIQFVASTKVZTEIHRSQGRKC JMKYWTUADWQAFPRTYLPSYHICWMPWOVEWQUODICNY SDFKOXKFMUNNXDKHXAOQSKMWWISUOFCMPCASPTGP YADICIEZBMHEVRECWBZPYRVZEGKBLECMHJFPTPUG INVFDUQMMTFHLIAJTOGIRDAMDCUOHUQFYNNNWJWI ZYCIHILMZVJYJQMKZUIHKUGWNUISBXUKFRXEJXKB LVMJGJGMAGZVOMZGMENBUOMWSXPVCGHQOVNTSUFF XTYCBLTVXUXNFEDMQLWBEMRMKSFPOGJDKWGFULSJ AQDABNALSVJQMWYQVSSUNIFZROYTCQNOVUAERDDL YFCWZSARWARROWNUPIJCITGUXNMEFWTENVVDRGFN ZPKHPSNJYPWZTWSHAKKEDPLCTPLVJZKZKPALZMVS RXNIXMDXJZRTRYVRCONCAQWSGFVKKJIVIOAVTVSA TIAHCORWDVHCFQCNBUOUIXKZJFZUPVPAQDJMLCSC VTSQXHVICSYBUBRAYJKJUOBFZVXHHDRIDUMLMGWX LPLRYESQARNWSTSHUVJBQGBUTNKPKQYFZGGLCYYY YMKCIAXMNSWVRENDSZCXGCEQNLYFHVDDYHKXQHIX BGNVUGIBZPVWAYLLQYRRMVOCBBYDIEQXAGLUNMLG GSLSHXRKTNYMIQXVYRUDYILGXFQKPZDPNOJAJXPI OZXSPHPTWCBRTGEBENQGEOUQJLIIZYQPHRUNBPCY FRBKDWTJSFAPHOQEUYQGFBBCSAGQQFJFMRLNHNTP LRUKKMNZRYKRGMZKWUQTMCXLSMUYCKIKRNEUPUED QTBIHWFSNMNNIKHRDKXN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      ANORGRSJHPKXGJNZCBNQFUIRORCYEJKZIQRDFJMD ENOYFDESQFCSZBIPMTOFLYTWRBSDBQOGYGAFCZHN KWHZTQINEHLUCWOISYLDGYQEKNJEQLJRROVZJWDG VSKYOJXATFYJTUXIAPINBGBWLSFSLKBTABOYWVEL VJVNXPUWZETEYGGHFNSQVVHEWFRDCULLTDUXSLRD LNWUNPEZUIZJUVNRCHVUHWODOVFJYFPWTAGSFPVA QGSMKAVCTPVWCROKJGUABZWEJRMUSTMSJIPNPGUF EPTTSIJECQHDLIGRQXSICWPTGQYZVLVMJZMJQPQQ FMIJKVNXGXGQTVKEUABEMAGCDYIXORBMOZIVCDNQ GJFQUTTZMEVELUZBNLSKSCCHGNUOJTSIDQTLCIOP DZOCKUTFLHNRTNOJJAITRIXVUECCWXTIZICDIIGZ TGXEFMCYQZKDPTCVJJFWQSEVTZQPWRJVZSFCJEWH VHOVZBCGSBDLEQTSQHFTWZVVQEBTFLFUZVEFNIKQ SQFUHLXCHELJDXYPOLKXVYALJNCKMGDHPSTCJNVO AGUEUBGHQRHANLAJUNVBAVDNIVTCVNUYAXCDQSIY JDVZKWYVTSQDZQCGEBVSLSKBBQZZKZOUMRWWKDYQ RMLMBBNCDXXWUQSBONHNGAAJKAGNXTIBRMTIWCPX PJOVLHEHFTEWVCRDKHKNWXQTQGSHVNRSVDWHRHOX EOLKHVSWKCHLGLSSWUWIHHWEWRAKFQAVNJVGKAWJ KRDMUYUKDSSIWCIRXLZDODWLBOJCUSUBLCYDEOPZ OHSIDBEEYJZKCRIEVLNOKGNGIYXTXHQVZMFOSIKB HPBKYYVWNKQAOKCFSTCLCZKGLPKKBRFWYAKHFKFS WCIWBVPBHJGJMSQYPHWLAWIYAINLWRVVNALCYWTX ZPXOXHFBNJUAOCQFOEYCJOEAYYPKLCJUOXERQGLS MJVUIQKCSNYTIQTBHGWWRAOQRRRBUSGGBBFVBCBR YBAEWNHNETZFJGNENBEXTWKOAMCEHQNLFCGHVKUW ACLTCAJJRRNFSHIDCHIEUYHBBWDJZPRNEAAJBMPO FEPYKKVEWRRIXUZTQXQGYNAAZXTNPWOFQDPOSXKZ VJOCLNCSFRZXJHHUGCXBDPYXXDXQNTALRHGWLKVW NWJVMTFOIVABEEVGNWUTXCAMNNTNGECFINJKJXFM VTTHSFCXMCXHTDSYERBWJVUIUPTATHJRZPIGOHWR BNDRVABEOWJWOUUGREZVRHZJRQSAXHDJUAMRJGBH VEBWRZSJNLCLOEHHFGUYUZGKUNDVZSCTJLOTOKFG QSLBTHPWBDWGNRPMWFTHZLQWFJRTNIYZZDDBDDLU IPAAYEHZMVCYNLNRZMPGBXQJRFFFBNVPTDUWBCOC CIPRGJFGBRGCRUQYBXLBNDNUBMTZDKKZUNYGVWQA YFJAZFROMYACTZXHDZHSPOKOOSUFVNOAMKCBEZCW PEYWPSZJYBLWBPQEOGGTPUXAYHNJZHXPMCMRWYRR IBOBYIPUBEIEPNRVOERWGGTLHQZGJNQNXHBCBHVU KSEKAQTPPIEHQBXVNTKTFXMXJUOEAVQBEKWGUTNB IJNJNBBNAJKJFWCXEOADZFNBZREVZABILUHBDYPA KXWNWESLYVJKTOXJYMXREFHHXEWDAYLPDTDBQFBE YTLFZXCYFNYGVBZJYGSBTWZIYBLWXFTLDQDWDOLF ZLRQUKCEJVTPRBUYKEBOLNBMZXACUBMODEBCGNHU EJTRMBYNGLHBXAQHBKEAIMJPKXFGMGKAORIFYYOB ATDVAFIQRVQIVIMTXBNAFFXMJFWXEXXMANWFNMRY NZRLVPQRWFRAKQWEOSZMNRTGABJMYFYKUNHHRYEO WVJYEJFTKONWIKQPPREZ
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      GXMBFQNSWEMMSTEXRECAJTDDJTLSFHUXTMDFWDRL DGLVIODDPJNEFOBNSTSKVHXLBCPVLVOMTCJTAAJM INXBWGOKIPDALDIIBYCZAKFSGSSBLOSALPTSGKEE SCFMZOQGHJYMHPYUHYYPZGJLWWVRHJEDFIEBIIHO URPILWXBZBIWBAHPQDFEIOYXUWDVVORXPVMZEZWC HMDBTIZFOKVNSGLKUVFNSGWXOYCCOXJZLPFFTRBF NRWJOWLTIPRPHSGLERLJKCSYBHIGSYYYJEFUKVYT TYACWUDLPXPTHWJWNEZZKOXMZBIGLKEJWZGQJGJM QOKSDCMPDJGNSHQXDSFGXOKQCTYJLXRERSMCLSJZ LTIOZGJZTPKKKDBTTQWGUIKJYOGIWFCBVLTPFFEK SJJVSGZMDGQYUEGTIUMMBKZPUHATCECMDBVTWYOM QZMVNRKAEOVXCAACULWQZRWSXRWOOKTHXGDICBSI JIXTXCZBEFVUCGARRGOYDYSWDOUEYWYXUFIJOPHF WWPKQGXVHOHWFAHFOYUPQCPGZBZUKBJENZKXKYQA GOLNRIHCOPMBQOXMVUKDAUXUXAMPTKTUHMAUCROH SFSRBIBCMVIDQCVIVUJAWZTDHUPBBHITFEVMKWRD HQIDARDZILKULJULFCIAFCFDDZUDHOMVZZTLJBAJ VOLBUHSMAKQQPWAAPLHSFZLGHBNAYRQLYSIAWPTI SWETCJVHTWZBGQDMCZCSLVMCOLJQZBPJTPRITOQY FCKOLZIMVTFWGCTHGNBENLDRWBFWTOLJOOPMTWQL DHETMNMHUDBHIQXGUWRZSYPRNEVIMJSFKPVUBRGI MMQTZBQQSJDQNPAVNPUXLBKRJOSRLCRSVKPONORO ASOLKFDZAWUCLQPKIJUNRSCRVOVFRVFQKPSKVHLI YTTHKWLJUAKGVOUWXRJVAUOATXDMWQTZIWWSOOKH QSILWENVSEOPHJYMVOLQCYWBDRUEAJCDMDRWMSJW OFIHTYCEGNFDWEGFZKIAYFFKDJOBEWFHGLRVNOWE FLMHJJPMMFDKYZTHRBIKWXMGOYUEUHAROBOHKSOK OIKOTFQIJEXFPNRLRZWRDKQOIIWQSGAIRIORRRCE OLAYABZNRWESRAWPXCTGPLWGYJFAVHBMTDDJUIHO UMLPNORBBOBCJOUVXYFAHZJNBGGSWBGQIEVRWVOF SNOANOKDLKZMSDVBARTXBNDECUQTYYKXNMQUWVOU AVXOFLAJVPHBDERORPPYYHMVMNVUEMYYTPJOBVPO PELPEHEPDSAQWRXTARCZCSAZHXVJQITKGYBQLTZI UENQLVURFOOAHDWROAYGEGEEPINWGFGHEHUPAESR JFJOWTBNOUMPBIMUYWGFXAVZUWEECPIRGVFGZANY ULMCPVCVXVPRIFRUBNIDWWHQQZEPCXEVHCGHWQCM PKRUCZHYAHPRWNSDOHUBBPXOQXSAUAMFONFCXITF YFSJZGVKRKPTYLOSGFTOQCTLNHLVOUNLWDCTJKFP YRPBXKYPPKUWIKPOYXCEEAXSJWYHZPBJLAPEGFAQ PGADXIVRGINOYBCJDWKAXWABMLUSZXZZJRPXTXNO ZJNZDXAJSENEYBVAXOQZUZQJKJHUNRUXCQCNMSZG AVJEUJVRYHQEBXZGJEZUQVXMZAQHMACSQOUOVXBT UJBTXTPHLBIPVVVYKXIIPQIYEOIYLKTDJPKMHFPX KYFMPOTCORVDHTWKEYEHNQZZVXUDPKTNKIIJJXPA TYPGONBBQAEYLAJKLUGIRAEVCRWNACFNFGTTQXRO STRNFKPWCDFSNUWSLFMQAIBFSTNITNKSOUNYMRLK VXARABSZDCYODYFTMFEHXIRNSSRZCOMJBUDOGIIS FRCRUDPPOXXZGNLFUBYN
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      OVKZXSSYFQEAFQJRMHGKFWEFXGJFDLWTJXZQBQSI QBDWRVZIERIWUOLNMQBANKQAFZMMZCCCQUNDGEKM LWWLFONPNZNHQQQSGHXZKXHRCTADXMZNWPDJTNJG UGSKFFQXZEZYPKNBPWVVGLZIVEWOOIFNAYJVVSMM NFDXPNXGQVUYGONVZZWZXYZXEUZGUODPEJKUGOVQ QHQXACXDYHALFWJCYCMDFMSKQTBUCNIVQOBSCLAI TMRDEBYYSYLUPBLNSYVCURYCGTSQCBWVZWENCPHC VFOMZPUFJPCZRQMELTYEKGCRGBSMREQIFIYTHYAR FSTCTIIIMBRTACPLXDJWTNFFFQSMYOKBONYDFOJR MQKMZBPBVYMKYZWKXIUBJYZWCVUIIOSJJADFWCPR XLZBIUXFQZCYTJLDLYWXZTMKBDQOSBWIDFWGMFQD JTDMUGDSAHSENANNGZIRRCUTTMGMYJFCEZBEMJVY PHXYPAYNGAKYXUEBYYIBCLIYWOWIEQRQIQGTYZKF PRZBXGXUCQZGBIGAFBZYGFJZQXOISPMJNKZCQZMF IVRDODAZAOBCTFTYYNQRQTDSJQBCDMKERVOABSIF HULIBRVUIFTXOZHHARAYLPYAMKQITJTMTTVLPXFQ PLUQRVOXKXPTKCSVUFJRAUMGNLLZNQLXDNBJMSWG SQNGFCIUEEKBACLMLZXSNOUNUTBWHOKVDJBGCJUG AKHVKIQFOVIZWOCWGUGBINZAXNRREJRYESDDPAVR RUACEYQLRYJBRZGXIETYSCZQMOLHDOTKZHYHMLIF IOMQABHGXBWXROPMDVDEBJZTXSZYSXTCPHUUFUHN KTSXKHOOWHUGNNVZWQTCSHXJSTQXTPQNCFXTPSXY FBSNTQUDGWSMFFZVSJLMGXIVSVFEANREMZBGMQBA CALXNNUNXJDDWKAJOHCSUQKFZTIXSKOBUOCTUGCX PDJSOPWVWBEEVUVRXHSKCAMPSBOEQGOVJLUTECMT XFPUOYFMXXIACCMZWXAHZELEKCWLXWSDOPPTAKJN GHMJHWWCTSOEACBFZHHPTUAOZHMLKSSQPXRZXRTB AJVBOWAGQSWXUOPAKIINXRPQHAZRIAUKNFWXJYSZ UZGHFWOOYQKOHETGCKCRKSSZYJSDPOOBIDJLLCWA OCCGOOOWQZQQPVVJIDGXOMYWHDOBJRIRGQYDOVCK GTFJKSGITVCRDUYVKHERQWFEFIZAFNSFJUJOZPOG FJXCLTHYXYLNXRQRCMFPNNYFVPJRVRPMIRMSCCGS ICKUFJLYUAWRXYJCZYLFNIGMCTFTJJZNXGJVJNUV DRJQZUKBRYRKSQJCYIDOKJLQBRYTMJQMYULKAPFA YJHFNOGZKFYOLQMDTMSUYDUOUSIYNWTKWVZZTUVX BUXQXBAFGUXSYVNSYZKGMBQGZBXXBZVSJDLENCGE TCVLIHNMMWFSICRUQSYCAUMYQJOJGQLQYINKYMFY VRVUIRMCYZLEFDKXXNZAOBSNPBSFJPAFOLWAPGDG SXUTBOADMJRTKMYCJHDKORKTTEOCGJEPPKWKEBCE CCHZKQJIILVTXJFIMNQLDDRGISQSMDXPFPJDRSMY HHNRIACOMYTLCTFTESYKENIPRYXVSMCNFPVTDJJV RAKDTASHKZEDZHATNOFEGJCDOKTYSUOWSCZXYZRY MQGYACGEHSWMCCILIYCLQEERIVLJEVJCSGFLZTCC NCCPQTVTMDFNDCTNAFBGGRDOVKDUZCLVWRYBPPYW GPKOXIDZPDWQMIVBFHZOANRSXAAXEGNWFNOHOGLW MRXRDEFJOCLOWHLWOIYNEZLIFZACAGNUWDWWKLEW QPBYESLUQNCWUIQELEYBVXOHEYNVAHRUXBOQIPPS QIHECCWHNQOOYQNEOKAI
      Ответить
    • #на правах оффтопа
      Ку-ка-ре-ку!
      NYKBMKDDGRVYMKSWAOUSKNBPTIIBUZQCKGMHNOEF AWRCNFPSVQJESBQGAQOHCWSLSSQWEBLQCYFCAKNI HEUEBTMUPQVTVJBVVKCDOOVPVWUMIJYXIDDMXIGJ